KEGG   Synechocystis sp. PCC 6803: sll1579Help
Entry
sll1579           CDS       T00004                                 

Gene name
cpcC
Definition
(GenBank) phycocyanin associated linker protein
  KO
K02286  
phycocyanin-associated rod linker protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Photosynthesis - antenna proteins
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Energy metabolism
   00196 Photosynthesis - antenna proteins
    sll1579 (cpcC)
Photosynthesis proteins [BR:syn00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    sll1579 (cpcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(725413..726234)
Genome map
AA seq 273 aa AA seqDB search
MTSLVSAQRLGIVAVDEAIPLELRSRSTEEEVDAVILAVYRQVLGNDHLMSQERLTSAES
LLRGREISVRDFVRAVALSEVYRQKFFHSNPQNRFIELNYKHLLGRAPYDQSEIAFHTDL
YHQGGYEAEINSYIDSVEYTENFGDWVVPYFRGFATQRNQKTVGFSRSFQVYRGYATSDR
SQGNGSRSRLTRELARNTASPVYAGSTAESLRGTSAGSRNQMYRLQVIQGAAPGRGTRVR
RGKAEYLVSYDNLSAKLQQINRQGDTVTMISLA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgactagtttagtttcggcccagcgtctgggcattgtggccgtggatgaggctattccc
ctcgagcttcgttcccggagtacagaggaagaggtggatgccgttatcctggcggtttac
cgtcaagttttgggcaacgatcatctcatgtcccaggaacgactgaccagtgcagaatct
ttgctccggggcagggagatttcggtaagggattttgttcgggctgtggctctgtcggaa
gtgtaccggcagaagtttttccattccaacccacaaaatcgttttatcgagcttaattat
aagcatttactgggacgggctccctacgatcagtcggaaattgctttccacaccgatctt
tatcaccaggggggctatgaagcggagatcaattcctatattgactccgtagaatacacg
gaaaactttggagattgggttgtaccttatttccgcggctttgctacccagcggaatcaa
aaaaccgttggtttcagccgttctttccaggtgtatcggggctacgctaccagtgatcgt
tcccagggaaatggttcccgttctcgattgacgcgggagttggctcgcaatacagcttct
ccggtgtatgccggttctacggccgagagtttgcggggaacttcggcgggtagtcgtaac
caaatgtatcgtttgcaagtgattcaaggggcggcccccggtcgtggcacccgagtgcgc
cgtggtaaagcggagtatctagtttcctacgataatttgtctgccaagttgcaacaaatc
aatcgccaaggagatacggtcacaatgatttcccttgcctag

DBGET integrated database retrieval system