KEGG   Synechocystis sp. PCC 6803: sll1676Help
Entry
sll1676           CDS       T00004                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    sll1676 (malQ)
Enzymes [BR:syn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     sll1676 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(245502..247019)
Genome map
AA seq 505 aa AA seqDB search
MLDKRCSGILLHPTSLPSRFGIGDLGDGAFQFIDFLADADQSVWQILPLGPTGFGNSPYL
CYSALAINPWLISLDRLAEEGFLPPSLLDQAPPFTNPRVDYDQAIAYKSQVLKQAFAQFR
TNIELAIEQEFAEFCQAQSDWLADYALFMAIKEAHNGAGWHQWDKDIAWREPEALKIWGD
RLKTEVLYHQFLQFLGFRQWQEVKAYANQRHIAIFGDLPIYVAHDSADVWANPENFCLDP
ETGEAAMMAGVPPDYFSATGQLWGNPVYDWETLKATGFAWWIKRFKANLQYLDIVRIDHF
RGFESYWGVPQGEKTAENGEWYPAPGKEFFQALGKALGDNLPIVAEDLGVITPEVEALRD
EFNFPGMKVLHFAFDSDRGNPFLPFNYSNGNAVVYTGTHDNDTTVGWFQERSEDDQQKVI
NYLGCVCNEGIHWSLIRLASSSVAALAIFPLQDILGLGSDCRMNLPGTAAGNWGWRYHPD
QLNDWLSGHLSFITELYGRRIYHTD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgttagataaacgctgtagcggtattctgctccatcccacctccttgcccagtcgtttc
ggcattggggacttgggggacggtgcttttcagttcatcgattttttggcggacgcagac
cagagtgtatggcaaatattgccgttgggccccaccggattcggcaattccccttacctt
tgctattctgccctagcaattaatccttggttgattagccttgatcgcctagctgaagaa
ggatttttgccaccgagtttattagaccaagcccccccatttactaaccccagggtggat
tatgaccaggcgatcgcctacaaatcccaagttttaaaacaggcctttgcccagttccgt
accaacatagagctagcaattgagcaggaatttgcagaattttgccaagcccaaagtgat
tggctagcagattacgccctgttcatggccatcaaagaagcccacaatggagccggttgg
catcaatgggacaaggacattgcctggcgggaaccggaagccctgaaaatctggggcgat
cgcctgaaaacggaagttttataccatcaatttttgcaatttcttggttttcgccaatgg
caggaagtcaaagcctacgctaaccaacggcacatagccatttttggggacctacccatc
tacgttgcccacgatagcgctgacgtttgggccaatccagagaacttttgccttgatccg
gaaaccggagaagcggccatgatggccggggtaccaccggactatttcagtgccacaggg
caactctggggtaatcctgtgtacgactgggaaaccctcaaagctacgggctttgcctgg
tggattaagcgttttaaagccaatctgcaatatctagacattgtccgcattgaccatttc
cggggcttcgagtcctattggggagtgccccaaggggaaaaaactgctgaaaatggcgaa
tggtatccagcccccggcaaggaatttttccaagccctagggaaagccctgggtgataat
ttacccattgtggccgaagatttgggggtaattactccggaagtggaagcgctacgggat
gaatttaactttcccggcatgaaagtgctccatttcgcctttgactccgaccggggtaat
ccctttctgcccttcaactacagcaatggcaacgcggtggtttataccggcacccacgac
aacgacaccaccgtgggctggtttcaggaacggtcagaggatgatcagcaaaaggtgatc
aattacctcggctgtgtgtgcaacgaaggtatccattggagcttaattcgcctagcgtcc
agttcggtggcggccctagcaatttttcccctccaggacatcctcggtttgggtagtgac
tgtcgcatgaacttaccgggcactgcggcgggcaactggggttggcgttaccatcccgac
caactcaacgattggctatcggggcatttgagtttcattacggagctttacggacggcgc
atttaccacacagactag

DBGET integrated database retrieval system