KEGG   Synechocystis sp. PCC 6803: sll1734Help
Entry
sll1734           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(935409..936704)
Genome map
AA seq 431 aa AA seqDB search
MTTLTPKATLPPSTHPFADVIHRLEAGGSMLPDTPENLMQIIGIYKAYAVPMDFYWRDLL
YIAERVFLNPLRFFKYFLPQEYLDLANHYAGETADLRIWRGEASAHPELLEFMEKGNTTK
MPKLFHHLWHDRINMEFAEACMQAMLWHGRDMGMGKFDTYLDSDEYKANADKAIRAYFKG
NPPMLALYKLFPDLFLEQVRELSYYSNLGLFWEVMAPVFFEMSDIYDEGGFKGVPDAMNF
LVNGIFAIAGRPIYHHVYIDGECLEIIPKSKGFTWLYEAALPYVEAVFYRTAPFRGTKSY
NAQAKQVPEEQKDFHYGILYADVFPVGTAGIPPTLLMDDMLHFLPPYLIEYYQKHCRGED
DMLVQLGITFQRSMYNVTSAVIQALRTALLYPLDDPNPRHLAKNRQFFEAQIDRFLRPEA
RLKDIQSDSYR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgactaccctgaccccaaaagctaccttacccccctccacccatccttttgccgacgtt
atccatcgcctcgaagccggtggctccatgttgccggacactccggaaaacttgatgcag
atcataggtatttacaaagcctatgctgtgcccatggatttttactggcgggatctgctc
tacattgcggaacgggtatttctcaatcccttgcgtttctttaaatattttctgccccag
gaatatttagatcttgccaaccactatgctggcgaaactgctgatctgagaatctggcgg
ggagaggcttctgcccaccctgagttgctggagtttatggaaaaaggcaacaccaccaaa
atgcctaaactgttccatcacctctggcatgaccgcatcaacatggagtttgcagaggca
tgcatgcaagcaatgctatggcatggccgggacatgggcatgggtaaatttgatacctac
ctagatagtgacgaatataaagccaacgcagataaagcgattcgagcttactttaagggc
aatcccccgatgttggcgttatataaacttttccctgatttatttttagaacaggtcaga
gaactatcctactactcaaatttggggcttttttgggaagtaatggcccccgtatttttt
gaaatgtccgacatttacgatgagggcggttttaaaggagttcctgatgccatgaacttc
ttagttaacggtatttttgccattgctggccgccccatttatcaccatgtttatattgat
ggcgaatgtttagaaattattcccaaatctaagggttttacctggctttatgaagcggca
ctaccctatgtggaagctgttttttaccgcactgcaccattccgggggaccaaatcctat
aatgcccaggccaaacaggtgccggaagaacaaaaggattttcactatggtattttgtat
gccgatgtattccccgttggtactgcgggcattccccccacgctgttgatggatgatatg
ttgcactttttgccaccatatttaatcgagtattatcaaaaacattgccggggtgaggac
gatatgttggtgcagttggggatcactttccagcgctcaatgtacaatgttacctcagca
gtcatccaggctttgcggacggcattgttatatcccctagatgatccgaacccccggcat
ttggctaagaatcggcaattttttgaagctcaaatagaccgatttcttcgtcctgaagcc
cgcttgaaagatattcaaagcgatagttatcgttaa

DBGET integrated database retrieval system