KEGG   Synechocystis sp. PCC 6803: sll1920Help
Entry
sll1920           CDS       T00004                                 

Definition
cation-transporting ATPase E1-E2 ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
syn  Synechocystis sp. PCC 6803
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(764301..766538)
Genome map
AA seq 745 aa AA seqDB search
MAQTINLQLEGMRCAACASSIERAIAKVPGVQSCQVNFALEQAVVSYHGETTPQILTDAV
ERAGYHARVLKQQVLSSQQTEDRKPVFSAKLVTGLVISAVLFFGSLPMMLGVNIPHFPHI
FHDPWLQWLLATPVQFWSGAEFYRGAWKSVRTRSATMDTLVALGTSAAYFYSVAITLFPQ
WLTSQGLAAHVYFEAAAVVITLILLGRSLEQRARRETSAAIRKLMGLQPQTALVKRGEHW
ETVAIAELAINDVVRVRPGEKIPVDGVVVAGNSTVDESLVTGESFPVDKTVGTEVIGATL
NKSGSLDIQVSKLGQDSVLAQIIQLVQQAQASKAPIQHFVDRITHWFVPTVIVVAIAAFC
IWWLTTGNITLAVLTLVEVLIIACPCALGLATPTSVMVGTGKGAEYGVLIKEASSLEMAE
KLTAIVLDKTGTLTQGKPSVTNFFTLSPTSTEESLQLIQWAASVEQYSEHPLAEAVVNYG
QSQQVSLLEIDNFQAIAGCGVAGQWQGQWIRLGTSNWLTDLGVTGTEHQPWQSQAQQWEK
EQKTVIWLAVDTEVKALLAIADAIKPSSPQVVQALKKLGLSVYMLTGDNQATAQAIADTV
GIRHVLAQVRPGDKAQQVEQLQQKGNIVAMVGDGINDAPALAQADVGIAIGTGTDVAIAA
SDITLIAGDLQGILTAIKLSRATMGNIRQNLFFAFIYNVIGIPVAAGLFYPLFGLLLNPI
LAGAAMAFSSVSVVTNALRLKKFCP
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaaccatcaatctgcaactagagggaatgcgctgtgcggcctgtgcttccagc
attgaacgggcgatcgccaaagtgccgggggtgcagtcttgccaggtgaattttgccctg
gagcaggcggtggtcagttatcacggggaaacgaccccccaaatcctcacagatgcggtg
gagcgagcgggttaccacgctagggtgcttaaacaacaggttttatcttcccagcaaacc
gaggataggaaacccgtgttttcggccaaattggtaacggggttagtaatcagcgctgtg
ctcttttttggctccttgcccatgatgctgggggtaaatattccccattttccccatatt
ttccatgatccctggttgcaatggttattggctacgccggtgcagttttggtctggagcg
gagttttatcggggagcttggaaatccgttagaacccgcagtgccaccatggataccctt
gtagccttgggcaccagtgcggcgtatttttactccgtagccattaccctctttccccaa
tggttaactagccaagggttagcagcccacgtttattttgaagcggcggcggtggtgatc
accctgattctgttggggcggtcgttggaacagcgggcccggcgggaaacttcagcagcg
atccgtaaattaatggggctacaaccccaaacagcactcgttaaacggggggaacactgg
gaaacagtggcgatcgccgagttggcaattaacgatgtggtgcgggtgcggccgggggaa
aaaattccggtggatggcgtggtggtggcgggaaattccactgtggatgaatcgttggtg
acgggggaaagttttccggtagataaaaccgttgggacggaagtgattggggccacgttg
aataaaagcggcagtttagacattcaagtcagcaagttgggccaggattccgtgctcgcc
caaattatccaactggtacagcaagcccaagcttctaaagctcccatccagcactttgtt
gaccgcatcacccactggtttgtccccacagtaattgtggtggcgatcgccgctttttgt
atttggtggctgaccacgggcaatattaccctggcggtgttgaccttggtggaagtgctg
atcatcgcctgtccctgtgcgttgggcttggccacgcctacgtctgtgatggtgggcacg
ggtaaaggggcggagtatggcgtgctaatcaaagaagctagcagcctggaaatggcggaa
aaattaactgctattgtgctggataaaactggcacgttaacccagggcaaacccagtgtg
accaacttttttactctgtcccccacttccacggaggaaagtttacagttaatccaatgg
gcggccagtgtggagcaatattccgaacatcccctagcggaagcggtggttaattatggt
caatcccaacaggttagtttgctagagatagacaatttccaggcgatcgccggttgtggg
gtggcaggacaatggcaggggcaatggatacgattaggaacgtccaattggttaaccgat
ttgggggtaactggtacggagcatcaaccatggcaaagtcaggcccagcaatgggaaaag
gaacaaaaaaccgttatttggctggcagtggacacggaagttaaagctctattggcgatc
gccgatgccatcaaaccatcctctccccaggtagtacaggctctgaaaaaactgggttta
tccgtttatatgctcactggagacaaccaagccaccgcccaagccattgccgacacagtg
ggtattcgccatgtgttagcccaagtgcgccccggcgataaagcccaacaggtggaacag
ttgcaacagaagggaaatatcgtcgccatggtgggggatggcattaacgatgctcccgcc
ctggcccaggccgatgtgggcatagccattggtactggcaccgatgtggcgatcgccgcc
agtgatattactctgattgctggagatttacagggaattttgaccgctatcaagctgagc
cgggccaccatgggtaatattagacaaaatctcttctttgcgtttatttacaacgtgatc
ggcattcccgtagctgctgggctgttctatcccctcttcggtttactgctcaatcccatc
ctggctggggccgccatggcctttagttccgtttccgtggtgaccaacgctctgcgtctg
aaaaaattctgtccttag

DBGET integrated database retrieval system