KEGG   Synechocystis sp. PCC 6803: sll7106Help
Entry
sll7106           CDS       T00004                                 

Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    sll7106
Enzymes [BR:syn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     sll7106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
pSYSA:complement(join(101524..103307,1..85))
Genome map
AA seq 622 aa AA seqDB search
MEKSTDYLTGVIERITFHSEETGYTVARLQMSRAKELTTVVGNFANIQAGQTLKLAGIWK
EHPKYGSQFQVNNYHETKPATLTGIEKYLGSGLIKGVGPVTAKRIVAHFGLETLEIIEGE
SDRLMEVTGIGKKRVRMIQRAWAEQKAIKEVMLFLQGHGVSTTYAVKIYKEYGDDAIRVV
THNPYQLADDIFGIGFLTADKIAQQVGIDPTSKFRYRAGILHTLGEAAEQGHCYLPQPEL
IKAAIAKLSTEEYEAMAEALLAVIEEMVAVQDLIREILSEEEILLFKPTFYHTECKLAGY
VKQKLVNSQIIDIDRVKTWINRYTDKNELELSKQQYTAVLLAATTGVMILTGGPGTGKTF
TTRTIVALWRAMGKKIGLAAPTGRAAQRLGEMTGLEAKTLHRLLEFDPNSMGFKRNEDNP
LPFDAVIVDESSMLDLFLAHSLLKAISPNTQLLLVGDIDQLPSVGPGSVLGDLIASEQIT
MVRLNQVFRQAAASAIIRHAHQINRGQYPPMEAISDQPLSDCLWHNGGTEPDHGVQLIGE
LLTDFIPKQGFNLLQDVQVLCPMQRGIIGARNLNAVVQSIVVSNKAETLNATVRTDNFIK
RRVNRSVHSSSFQGTKVMLNII
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatcaacggattatttgactggggtgattgagcgcattacgttccattccgag
gaaactgggtacacggtggcgcgcctacaaatgtctagggctaaggaattaacgacggtg
gtggggaattttgccaatatccaagcggggcaaaccctgaaattagcaggcatttggaaa
gaacatcccaaatacggttctcagttccaggtcaataattaccacgaaaccaagccagct
acgttgacgggcattgaaaaatacctaggcagtggcctaatcaaaggggtagggccggtg
acagcgaaaagaattgtggctcattttggtttggaaaccctggaaattattgagggggag
agcgatcgcctgatggaagtaacaggcattggcaagaaacgggtcaggatgattcaaaga
gcatgggcggaacagaaagcgattaaagaagtgatgcttttcctccagggccatggggta
tccaccacctacgcagtcaaaatttataaagaatatggagatgatgcaatccgggttgtg
acccataacccctaccaattggcggacgatatttttggtattggttttctaacggcggat
aagattgcccaacaggtcggcattgaccccacgtctaagtttcgttatcgggcaggaatt
ctccatacccttggggaagcggcggaacagggccattgttatctcccccaaccagaattg
atcaaagcggcgatcgccaagttgagtacggaagaatatgaagcaatggcagaggcatta
ctagcggtaattgaggaaatggtggcagtgcaggatttgatacgggaaatattaagtgag
gaggaaatattgctattcaagcccactttttatcatacggaatgcaaattggccggttat
gtgaagcaaaagttagttaatagccaaattattgacatagatagagtaaaaacctggatt
aaccgttatacagacaaaaatgaactggaattatctaaacaacaatataccgctgtctta
ttggcggctacgacgggagtaatgattctcacgggtggccctgggacgggcaaaaccttt
actacccgcaccattgtcgctctttggagagcgatgggtaaaaagattggtttagcggct
cccacaggtagggcggctcaaagattaggggaaatgacggggttggaagcaaaaacattg
catcgtttgctggaatttgatcccaatagcatgggctttaagcgtaatgaagataatcct
ttgccctttgatgcggtgattgtggatgagtcctctatgttggatttattcctagcccat
tccctcctcaaagctatttctcccaatactcaactgctattggtgggggatattgaccag
ttaccttctgtggggcccggtagtgtgttgggggatttgattgcttcagagcagataacc
atggtcaggttaaaccaagtttttcgtcaggcggcggctagtgccatcattcgccatgct
catcaaattaacaggggtcaatatccgccaatggaagctatttctgatcagcctctatca
gattgtctttggcacaatggtggcacagaaccagaccatggagtgcaattaattggggaa
ttactaacagattttattccgaaacaaggttttaatctccttcaggatgtccaggtattg
tgtcctatgcaacggggaataattggtgctcgtaatttgaatgcggtggtgcaatctata
gtagtttcaaataaagctgagacgctaaacgccacagtaagaacggataatttcatcaag
agacgtgtcaataggagcgtacattctagctcgtttcaaggcactaaagtcatgctcaat
atcatttaa

DBGET integrated database retrieval system