KEGG   Synechocystis sp. PCC 6803: slr0543Help
Entry
slr0543           CDS       T00004                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    slr0543 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    slr0543 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    slr0543 (trpB)
Enzymes [BR:syn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     slr0543 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3213272..3214510
Genome map
AA seq 412 aa AA seqDB search
MNITSPLSAPSHQYPDALGRFGNYGGKYVPETLMPALTELEEAYYRYRAESSFQEELAGL
LKDYVGRSSPLYFAERLSAHYARPDGTYPLIYLKREDLNHTGAHKINNALGQVLLAKRMG
KKRIIAETGAGQHGVATATVCARFGLECIIYMGVQDMERQKLNVFRMNLLGARVQPVTAG
TGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHRVIGQETRQQALKKWGG
LPDILLACVGGGSNAMGLFYDFIDEPAVRLIGIEAAGESIVSGKHAATLTMGKPGVLHGA
MSYLLQDKEGQVTEAHSISAGLDYPGVGPEHSYLKDAGRAEYYSVTDQEAITALQRLSQL
EGIIPALETAHAFAYLETLCPQLKNGERIVINCSGRGDKDVQTVAKYLQMEI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaacattacttcccctctttctgcccctagtcatcagtatcccgacgccctgggtcgt
tttggcaattatggcggcaaatatgtgcctgaaactttaatgccggctctgacggagttg
gaggaagcttactatcgctaccgggcggagagttcctttcaggaagagttagcggggtta
ttaaaagactatgtgggccgttcctctcccctatattttgcggaaagattaagcgcccat
tacgcccgtcccgacggaacctatcctttgatttacctcaaacgagaagatttaaaccat
acgggggcccacaaaattaataacgccctgggccaggttctccttgccaaacgcatgggg
aaaaagcggatcattgccgaaactggtgctggtcaacacggggtggcaacggctacggtg
tgtgctcgctttggcttggaatgcatcatctacatgggggtgcaggatatggagcggcaa
aagctgaatgtctttcgcatgaatttgctgggggccagggtgcaaccagtcacagcgggc
actggaaccctcaaggatgctacctctgaagcaatccgggattgggtcaccaatgtggaa
actacccattacattcttggctctgtggccggaccccatccttaccccatgatggtgcgg
gacttccaccgggtcattggccaggaaactcgccaacaggcattgaaaaaatggggcggt
ctgccggatatcttgctggcttgtgtggggggcggctccaacgccatggggctgttctac
gatttcattgatgagccagcagtgcggttaattggtatcgaagcggcaggggaaagcatt
gtctccggtaagcatgcggccactttaaccatgggtaaaccgggggtgttacatggggcc
atgagttatttactccaggataaggagggtcaagtaacggaagcccattccattagtgct
ggtttagattatcccggtgtgggcccagaacatagctatctcaaggatgcgggacgggca
gaatattacagtgtcaccgaccaagaggcgatcaccgctttgcagagattatcgcaattg
gaaggaattattcctgctctggaaactgcccatgcctttgcctacctagagactctctgc
ccgcaactgaaaaatggcgagcggattgtgatcaactgctccggccgcggggataaggac
gtacaaacggtggctaaatatctccagatggaaatttaa

DBGET integrated database retrieval system