KEGG   Synechocystis sp. PCC 6803: slr0546Help
Entry
slr0546           CDS       T00004                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:syn01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:syn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3240181..3241068
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPPIKVDILQYQIKHPEAAPRHILEEIVWHKEKEVAQRRELVPLVKLQSLVK
DMTPPLDFVGALRQSPRQPALIAEVKKASPSKGIIRADFDPVAIAKAYEAGGANCLSVLT
DEKFFQGSFENLQLVRSAVQLPLLCKEFIIYPYQIYLARSRGADAVLLIAAILSDKDLRY
FLKIIEGLGMAALVEVHTLEEMDRVLALDGVQLIGVNNRNLQTFTVDLQTTEDLFAQRRE
QLTQGDITLVSESGIYELADLQRLQQAGARAVLVGESLVKQPDPQQAIAALYGEV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcgccgccggcctcctaacccccccatcaaagttgacattcttcagtatcaa
attaagcatccagaagcggctccccgtcacattctggaggaaattgtttggcataaggaa
aaggaagtggcccaacggcgagaattagtccccctggtcaaactccaaagtttagtcaag
gacatgactcccccattggattttgtgggggcattgcgccagagtccccggcaaccggcc
ttaattgctgaagtgaaaaaggcttcccctagtaagggcattattcgggcggattttgac
ccagtggcgatcgccaaggcctatgaagcgggaggggctaactgtttatcggtgttgacg
gacgagaaatttttccagggtagttttgaaaatttgcaactggtacgctcagcggtgcaa
ttacccttgctgtgcaaggaatttattatttacccctatcaaatctatctagcccggagt
cggggggccgatgcggtgctgttaattgccgctatcctcagcgataaggatttgcgttat
ttcctcaaaattattgaaggtttgggcatggcggcgttggtggaagtccataccctggag
gaaatggaccgggttttggctttggacggggtgcaactaatcggagttaataaccgtaat
ttgcaaaccttcaccgttgatctgcaaaccacagaggatctttttgcccaacgacgggag
caattaacccaaggggacattactttagtgagcgaatccggcatttatgaattggctgat
ttgcaaagattacagcaggctggggcccgggccgttttagtcggcgaatccctggtcaaa
caaccagatccccaacaggcgatcgccgctttatacggtgaagtttaa

DBGET integrated database retrieval system