KEGG   Synechocystis sp. PCC 6803: slr0744Help
Entry
slr0744           CDS       T00004                                 

Gene name
infB
Definition
(GenBank) initiation factor IF-2
  KO
K02519  
translation initiation factor IF-2
Organism
syn  Synechocystis sp. PCC 6803
Brite
Translation factors [BR:syn03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    slr0744 (infB)
 Prokaryotic Type
   slr0744 (infB)
Mitochondrial biogenesis [BR:syn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    slr0744 (infB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
134437..137442
Genome map
AA seq 1001 aa AA seqDB search
MNNAKVRIYDLSKELNLENRDILDICERLNVAAKSHSSTISESDAERIKAAAEKFTPQQP
KKPRVASRPESKEDKSDPKQQKILAIHHKQEKSGGPSPARPTPPPRPKLQAPKAPTPPQP
PVAKASAPKIQKQEEPAQEAPKSVAPPTQPLAPPPVPSLQSPPSKPAPPTPPAKKAAPAP
RLAGPPGRTASPNKTAVPAPAKPKVNRPEIVSLKDNRGQARSPGDREEKVAIAAPEPPKP
KVELRRPKPPRPEEDENLPELLEFPPLSRGKGVDGDNDADDGDLLSTEKPKPKLKRPTPP
RLGKPDQWEDDEDEKANKAKAANKGKRRPKMDDDDDDLDIDGDNGPKPTLVSLSIARPPK
PKSLAAKPSTPTVAKVKKPTLKSEAGSSAGGSSRSRGDRRDRKEVVQKPEVIMLDRSLTV
RDLADLLKISETDIIKRLFLKGVAVQITQTLDEETARMVAESFEVAVETPERVAAAAKTT
EMLDEADLDNLVRRPPVVTIMGHVDHGKTTLLDSIRKTKVAQGEAGGITQHIGAYHVEVE
HNDKTEQIVFLDTPGHEAFTAMRARGAKVTDIAILVVAADDGVQPQTKEAISHAKAAGVP
LIVAINKVDKPEANPDRIKQELSELGLLAEEWGGDTIMVPVSALNGDNLDGLLEMILLVS
EVEELVANPNRQAKGTVIEANLDRTRGPVATLLIQNGTLRVGDAIVVGAVYGKIRAMIDD
RGDKVEEASPSFAVEILGLGDVPAAGDEFEVFTNEKDARLQAEARAMEDRQTRLQQAMSS
RKVTLSSISAQAQEGELKELNIILKADVQGSLGAILGSLEQLPQGEVQIRVLLASPGEVT
ETDVDLAAASGAIIIGFNTTLASGARQAADQEGVDIREYDIIYKLLDDIQGAMEGLLDPE
EIESSLGTAEVRAVFPVGRGNIAGCYVQSGKIIRNRNLRVRRGDQVLFEGNIDSLKRIKE
DVREVNAGYECGIGCSKFNDWKEGDIIEAYEMTMKRRTLAT
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgccaaagtcagaatttatgacctatcaaaagaattaaatctggagaatcga
gatattttagacatctgcgaacggctcaacgtggctgctaaaagtcatagcagtaccatc
agtgaatccgatgcggagcgcatcaaagcggcagctgaaaaattcaccccccaacaaccg
aaaaagcctagagtggcatcccgtccggagtcgaaagaggataagtcagatcccaagcag
caaaagattctagcaattcaccacaaacaggaaaaatctggcggtccatctccggcccgg
cccaccccccctccccggccaaaactacaagcgccgaaggcccccacgcccccccaaccc
cccgtggccaaagcttcagctccaaagattcagaaacaggaagagcctgcccaggaagcg
cccaaaagtgttgctccccccacccagcctttggcaccgcccccagtgcccagtttgcaa
tctccccccagtaagccagctccccctactcctcctgcaaagaaagcggctccagccccc
cgtttggcagggcctcctggtcgaacagccagtcccaacaaaaccgctgtccctgccccc
gctaaacccaaggttaaccgtccggaaattgttagtttgaaggataatcggggtcaagcc
cgctcccccggtgacagggaagagaaggtggcgatcgccgctccggaaccacctaagccc
aaggtagaattgcgccggcccaagcccccccggcctgaagaggacgaaaacttaccagaa
ttgctggaatttccgccccttagtcggggcaagggggtcgatggggacaacgatgccgat
gacggtgatctgctctccaccgagaaacccaagcccaagctgaagcgccctactcctccg
cgtttgggtaagccagatcagtgggaagatgacgaagacgaaaaagccaataaggccaaa
gcggccaacaagggcaaacgccggcccaaaatggacgacgatgacgatgacctggatata
gatggggataatggacccaagcctaccctggttagtctttccattgcccgtccacctaaa
ccaaaatccttggcggcgaaacccagcacccccactgtggccaaggttaaaaagcccact
ctcaaatccgaagcgggtagtagcgctggtggtagttcccgcagtcgtggcgatcgccgg
gatcggaaggaagtggtgcaaaaacccgaagtgatcatgttggaccggagcttgactgtc
cgggatctggcggatctattaaaaatttccgaaacagacatcatcaaacggctcttcctc
aaaggggtagcggtgcaaattacccaaaccttggacgaagaaaccgcccgtatggtggcc
gaatcctttgaagtggccgtggaaacccctgaaagggtcgccgccgccgctaaaaccaca
gaaatgctcgacgaagcggatctggacaacctcgtacgtcgtccccctgtggttaccatc
atgggtcacgtggaccacggtaaaaccacgttgctggactccatacgcaaaaccaaggtg
gcccaaggggaagcggggggtattacccagcacattggtgcctaccacgtggaagtggag
cacaacgacaaaaccgaacagattgtcttccttgatactcctggccatgaagcctttacc
gccatgcgggcccggggagccaaggttacggacattgccattctggtggtagccgccgat
gatggcgtccagccccaaaccaaagaggccattagccatgccaaggccgccggggttccc
ctcattgtggccatcaacaaagtcgataaacctgaagccaatcccgaccgcattaagcag
gaattgtccgaacttggccttctggctgaagaatgggggggagacaccatcatggtgccc
gtcagtgccctcaacggagataacctggatggcttgctcgaaatgattctgctcgtatcg
gaagtggaagaactagttgctaatcccaaccgtcaggctaaaggcaccgtgattgaggct
aacctagaccgcaccaggggtcctgtggctaccctcttgatccaaaacggtactctccga
gttggggatgctattgtggtgggggctgtgtacggcaaaatccgagccatgatcgacgac
cggggcgacaaagtcgaggaagccagtccttcctttgcagtggagatccttggtctaggg
gatgtgcccgccgctggggatgaatttgaagtctttaccaacgaaaaagatgcccgtctg
caagcggaagcccgggccatggaagaccgtcaaacccgtctgcaacaggccatgtcttcc
cgcaaggttaccctcagcagtatttcggcccaggcccaggaaggggaactcaaggaactc
aacatcatcctcaaggcagacgtacagggttccttgggggctattttaggctccttggaa
caattaccccaaggggaagtacagatccgagtcctgttggcgtccccaggggaagtcacg
gaaaccgatgtggatttggccgccgccagtggagcaatcatcattggcttcaacaccacc
ttggccagtggagcccgtcaagccgcggaccaagaaggggtggacattcgggaatacgac
atcatctataagcttttggatgacatccaaggagccatggaaggtctcttggatcccgaa
gaaattgagtcttccctgggaacagcggaagtgcgggctgtcttccccgtgggtcggggt
aatattgccggttgttacgtgcagtcaggcaaaattatccggaatcgtaacctgcgggtg
cgccggggtgaccaagtgctctttgaaggcaacatcgattccctcaaacggattaaggag
gacgtgcgggaagttaatgctggctatgagtgcggcattggctgtagcaagttcaacgac
tggaaggaaggagacatcatcgaagcctatgaaatgaccatgaagcgtcggacattggct
acctag

DBGET integrated database retrieval system