KEGG   Synechocystis sp. PCC 6803: slr0783Help
Entry
slr0783           CDS       T00004                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    slr0783 (tpiA)
   01230 Biosynthesis of amino acids
    slr0783 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    slr0783 (tpiA)
   00051 Fructose and mannose metabolism
    slr0783 (tpiA)
   00562 Inositol phosphate metabolism
    slr0783 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    slr0783 (tpiA)
Enzymes [BR:syn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     slr0783 (tpiA)
Exosome [BR:syn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   slr0783 (tpiA)
  Exosomal proteins of bladder cancer cells
   slr0783 (tpiA)
  Exosomal proteins of melanoma cells
   slr0783 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2423621..2424349
Genome map
AA seq 242 aa AA seqDB search
MRKIIIAGNWKMHKTQAEAQAFLQGFKPLIEDAAESREVVLCVPFTDLSGMSQQLHGGRV
RLGAQNVHWEASGAYTGEISAAMLTEIGIHYVVIGHSERRQYFGETDETANLRVLAAQKA
GLIPILCVGESKAQRDAGETEQVIVDQVKKGLVNVDQSNLVIAYEPIWAIGTGDTCAATE
ANRVIGLIREQLTNSQVTIQYGGSVNANNVDEIMAQPEIDGALVGGASLEPQSFARIVNF
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaatcattattgcgggcaattggaaaatgcataagacgcaggcggaggcccaa
gcgtttttgcaggggtttaaacctttaatcgaagatgcggcggaaagtcgtgaggtggtg
ttgtgtgttcctttcaccgatttgagcggcatgtcccaacaactccatggcggtagggtc
cgcctaggggcacaaaatgtccattgggaagcgagtggggcctacacaggggaaatttca
gcggctatgttgacggaaatcggtattcattatgtggttatcggccacagtgaacgacgg
caatattttggggaaacggacgaaactgccaatttgagagtattggcggcccaaaaggcg
ggcttaattcccattctgtgtgtgggggaaagtaaggcgcaacgggatgccggagaaacg
gaacaggttatcgttgaccaagtgaaaaaaggcttggtgaatgtggatcaatctaaccta
gtcatcgcctacgagccgatttgggccattggtacaggggacacctgtgcggcaacggaa
gccaatcgggttattgggctgattcgggaacagttaactaattcccaggtcaccatccag
tatggcggttcggtcaatgccaacaatgtggatgaaattatggcccaaccggaaattgat
ggagccttggtgggaggagctagtctggaaccccagagctttgcccgcattgttaatttt
cagccctga

DBGET integrated database retrieval system