KEGG   Synechocystis sp. PCC 6803: slr0795Help
Entry
slr0795           CDS       T00004                                 

Definition
(GenBank) unknown protein
  KO
K11331  cation efflux system protein involved in nickel and cobalt tolerance [EC:3.2.1.17]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    slr0795
Enzymes [BR:syn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     slr0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme
Motif
Other DBs
NCBI-ProteinID: BAA10701
CyanoBase: slr0795
CYORF: slr0795
UniProt: Q55936
Position
3054872..3055699
Genome map
AA seq 275 aa AA seqDB search
METTLLLLCVTIGSALKNRIFKRELLSLLAVLTTVGEIFLPHFFWLISMTITQNTTRHYH
HRRRSQQSSWSRHFFLATLLFTLCLAAFIRKSPETENINSFFGHLPSLAMEGGDPYIRAL
MRTISASESNAKNPYVLLYGGQHTHDLSRHPNACIAIKTDVNQGHCSTAAGRYQFLTKTW
QEKAALYHPQRHLGKSHYNFEPEFQDLVTYRWLTDKHHWGMDFSTQLQQGNIEQVLKKLS
GTWTSLGYGIEDNRMTASLPKIYQKLLAEELDQAN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagaccacattgctccttttgtgcgtaacgatagggtcagcactcaaaaatcgcatt
tttaaacgtgaattattatctcttctggctgtattaacaacggtgggagagattttttta
ccacattttttctggttaatttccatgaccattacccaaaacacaactcgccactatcat
catcgtcgaaggtctcaacaatcatcttggtcacgccatttttttctggccactttatta
tttactctttgcttggcagcttttattagaaagtctcctgaaactgaaaacatcaattcc
ttttttggccatttaccatccctagccatggaaggaggagatccttacattagagcttta
atgcggacaatttcagccagtgaatctaatgctaaaaatccctacgttttactctatggc
ggtcaacatacccatgatttaagtcgccatcccaatgcttgtattgccatcaaaacagat
gttaaccaagggcattgctccacagcggcaggacgttatcaatttttgactaagacttgg
caggaaaaagcggctttgtatcaccctcaacgtcatttgggaaaatcacactataacttt
gagcctgaatttcaggatttagtaacctatcgatggttgaccgataaacaccactggggc
atggacttttccacccaattacaacagggaaatatcgaacaagtgttgaaaaaactttct
ggcacttggacaagtttgggttacggcattgaagacaatagaatgaccgcttctttaccc
aaaatttatcaaaaactattagcagaagaacttgaccaagctaattaa

DBGET integrated database retrieval system