KEGG   Synechocystis sp. PCC 6803: slr0797Help
Entry
slr0797           CDS       T00004                                 

Definition
(GenBank) cation-transporting ATPase; E1-E2 ATPase
  KO
K01534  
Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]
Organism
syn  Synechocystis sp. PCC 6803
Brite
Enzymes [BR:syn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.3  Cd2+-exporting ATPase
     slr0797
    3.6.3.5  Zn2+-exporting ATPase
     slr0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3058411..3060339
Genome map
AA seq 642 aa AA seqDB search
MVVTPPSSAFRFSNLFKDHPDAVAAIACGGLVFLGWQMLNLGWLGIAFFVLTAAYVIGGF
DNAREGLTTLFEEKEFDVDLLMIVAALGAAGLGLWRREYTLIVDGAVLILIFAISGALEG
YAMQRTERSIQGLMSLTADVARVLRNGQEQTIPISELKMGDQVLVKPGELVPTDGLVIEG
FSTLNQASITGESMPVEKAIGDEVFAGTINGNGVLRLKIHQPPESSLIQRVIRLVQQAQT
EAPPSQQFIERFECGYAKVIVIAGLLLGTLPPFLLGWSWEETIYRALIFLVVASPCALMA
SIMPALLSGIANGARQGILFKNGAQLERIGRVRVIAFDKTGTLTTGKPEVVNILATQPST
DKLLQIAAALESLSEHPIGEAIADFTRQQNQAWATARNVQAQAGQGIIGDIEGQQAIVGK
AVFVQAQVNHVATNLIEQSQQWEAEGKTVVWVAYAGEILGLIAVADTVRPTAAQAIARLK
RLGIERIVMLTGDNSRTAHSIAQQVGVNQVYAELLPEDKVDVIRQLQKQYQSVAMVGDGI
NDAPALAQASVGIAMGAAGSDVALETADIVLMADRLERLEHAIRLGRRAQGVVKQNIVFA
LGFVMILLIANFAGNITLPFGVLGHEGSTVIVTLSGLRLLRG
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaactcccccttcttctgcctttcgattttctaaccttttcaaagatcatccc
gatgcagtggcggcgatcgcctgtggcgggctggtctttctgggctggcagatgcttaac
ttgggctggttgggaattgccttttttgtcctaacagcggcctatgtgattggtggattt
gacaatgcccgtgagggattaacaaccctctttgaagaaaaagaatttgatgtcgatctg
ctgatgattgtggccgccttgggggccgccgggttgggactttggcgacgggaatatacc
ctcattgtggatggggcagttctgattcttatttttgccatcagtggggcattggaagga
tacgcgatgcaacggacggagcggagtatccagggattgatgagcttaaccgctgatgta
gcaagagtgttgcggaacggacaggagcaaaccattcccatttcagaactgaagatgggg
gatcaagtcttggtgaaaccgggagagttggtgccaacggatggcttggtcattgaaggg
tttagcaccctgaaccaggcttccatcacgggggaatctatgccagtggaaaaggcgatc
ggcgatgaggtgtttgccggcacgatcaatggcaatggggtactgcggctcaaaatccat
caacccccggaaagtagcttgattcagcgtgtgattcgtttggttcagcaagcccaaacc
gaagctcccccgtcgcaacagtttattgaacgatttgagtgcggttatgccaaggtaatt
gtgatcgccggactcttgctcggtacgttgccgccttttttgctgggctggagttgggaa
gagacgatctaccgtgccttaatttttctcgtggtggcttctccctgtgcgctaatggca
tcaattatgccggccttactttctggtattgccaatggagcgcgtcaaggcattttattc
aaaaacggggcgcagttggagcggattggacgagtacgggtgattgcttttgataaaact
ggaacattgaccactggaaaacctgaagttgtgaacattctcgccactcagccatccacc
gacaaacttctgcaaatcgcggcggccctggaaagtttatcggaacatcccatcggagag
gcgatcgccgacttcacccgtcaacagaaccaagcctgggcaacagccaggaacgttcaa
gcgcaggcgggacagggcattatcggagacattgagggccaacaggcgatagttggtaaa
gccgtgtttgttcaggcccaggtcaatcatgttgctacaaacctgatagagcaaagtcag
cagtgggaagctgaaggtaaaaccgtcgtctgggttgcctacgctggagagattttaggt
ctcattgccgtggcagatactgtacgacccaccgccgcccaggcgatcgcccgattaaaa
cgattaggaattgagcgaattgtcatgctaactggggataactcacgtaccgcccacagc
attgctcaacaggtgggagtcaatcaggtttatgcagaacttttgcccgaagataaagtg
gatgtgattcgccaactccagaagcagtatcaatccgtcgccatggtgggagacggcatc
aatgatgcacccgccttagctcaggcatctgttggtattgcgatgggggccgctggtagt
gatgtggccttagaaaccgcagatattgtcttaatggcggatcgtttggagcggttagaa
cacgccattcgtttgggtcgtcgcgctcaaggagtggtcaaacaaaacattgtgtttgcc
cttggttttgtgatgattctgttgattgcaaactttgcgggtaatatcacgctgcccttt
ggggttttggggcatgaaggctcgacggtaatcgtaacgttgagtggattgcggttacta
agagggtaa

DBGET integrated database retrieval system