KEGG   Synechocystis sp. PCC 6803: slr0966Help
Entry
slr0966           CDS       T00004                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    slr0966 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    slr0966 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    slr0966 (trpA)
Enzymes [BR:syn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     slr0966 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
326150..326944
Genome map
AA seq 264 aa AA seqDB search
MNAVAACFNALRQRGECALIPFLTAGDPDLATTAEALRILDRAGADLIELGVPYSDPLAD
GPVIQAAATRALQKGVKLDDVLAIVREVHQDIAAPIILFTYYNPIFYQGVEVFLDKIKAA
GVKGLVVPDLPLEESDRLLEATAERGLELILLVAPTSSPERQTAIAKKSQGFVYLVSVTG
VTGVRTEVGSRVEALLAGMRQVTDKPIGVGFGISQPEQAEQVKAWGADAVIVGSAMVKRL
AEGTPTEGLQALETFCRELKTAIS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgttgccgcttgttttaatgcccttcgtcaacggggggaatgtgctttgatt
cctttcctcacagcgggggacccggatttagccaccacagccgaagcgttgcgaattcta
gaccgggcaggggcggatttaattgagttgggagtgccctattccgatcctttggccgat
ggcccggtgattcaagcggcggccactagggctttacaaaaaggggtcaagttggatgat
gtgctcgccattgtccgagaagttcaccaagatattgccgccccgataattttatttacc
tattacaatcctattttttatcagggtgtggaggttttcctcgacaaaatcaaggccgct
ggagtgaagggtttggtggtgccggatttacccctggaggaatctgatcgcctgttggaa
gcgacagcggaaagggggttggagttaattttgttggtggcccccaccagttccccagaa
agacaaacggcgatcgccaaaaagtcccagggctttgtttacttggtcagcgtgacaggg
gtgacgggggtgagaacggaagtgggatcgagggtggaagctttgttagcagggatgcgc
caggtcaccgataaaccgattggagttggttttggtatttcccaaccggaacaggctgag
caggtgaaagcttggggcgcagatgcagtaattgtaggaagcgccatggttaagcgttta
gcggaaggaaccccgacggaaggattgcaagctttggaaactttttgccgggaactgaaa
acggccatcagttaa

DBGET integrated database retrieval system