KEGG   Synechocystis sp. PCC 6803: slr0985Help
Entry
slr0985           CDS       T00004                                 

Gene name
rfbC
Definition
dTDP-6-deoxy-L-mannose-dehydrogenase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:syn00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:syn00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
355424..355993
Genome map
AA seq 189 aa AA seqDB search
MTTMGRFLTEDLGIAGLRTVIRQPIGDRRGFLARLFCAEELKEVGWHKPIAQINHTHTAQ
GGTVRGMHYQNPPSAEMKLVTCIRGQVWDVAVDLRVDSPTFLTWQGVVLSADNNRALLIP
EGCAHGFQALSDDVELIYCHSVAYNPMAEGGLNPQDPRLGIEWPQAITELSQRDQNHPLL
DSTFLGLSL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgactactatgggaagatttttgactgaagatttgggcattgccggactcagaaccgtt
atccgtcagcccatcggcgatcgccggggatttttggcccgtttgttttgtgctgaggag
ttgaaggaagtaggttggcataaacccattgcccagattaaccatacccatacggcccaa
ggcggcactgtgcgaggtatgcattaccaaaatcctccctctgcggaaatgaaattggtt
acttgcattcggggtcaggtttgggatgtggcggtggatttgcgggttgattcccccact
tttttgacttggcaaggggtagtactaagtgcggataacaatagggcattgttgataccc
gaaggctgtgcccatggttttcaagccttgagcgatgatgttgaattgatttactgtcac
tcggtcgcctataacccgatggcggaaggggggttgaatccccaagatcctcgcctaggg
attgagtggccccaagcaattaccgaattatcccagcgagaccaaaatcaccccttacta
gattccacctttttaggtctgagtttatga

DBGET integrated database retrieval system