KEGG   Synechocystis sp. PCC 6803: slr1093Help
Entry
slr1093           CDS       T00004                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
189128..189715
Genome map
AA seq 195 aa AA seqDB search
MAPVSPTDFPQQCHGAVVGLGGNIGPVLDNLQGAIAELALVAGIEVERCSSWYRSRAFGP
PQPDYINGCVTLRVSLSPPELLQTLLAIEQKFGRIRLEKWGPRTLDLDLIFYGDRQLEQA
RLTIPHPQMQYRPFVLVPLAEIAPDWVDPRSGKTIIQLIEQVDCTAVWPVAPGLELGGSL
EPEQVFAPGAVAVHG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgtctcccccacagattttccgcaacaatgccatggggcagtggtaggcttg
gggggcaatattggcccagtgctggacaatctccaaggggcgatcgccgagttggccttg
gtagcgggcattgaagtggagcgctgttctagttggtaccgtagccgagcttttgggccg
ccgcagcccgactatatcaatggctgtgtgacgttacgggtcagtttatcccccccagag
ttgttgcaaactttactggcgatcgagcaaaaatttggccgcattcgtttggaaaaatgg
ggaccccgcaccttagatctggatttaattttctacggcgatcgccaattggaacaggct
agactgaccattccccacccgcaaatgcaatacagaccatttgtgctagttcccctggcg
gaaattgccccggactgggttgatcctcggtcggggaaaaccattattcaactaattgag
caggtggattgcactgcggtttggccagtggctccagggctggaactaggggggagtctg
gaaccagagcaagtttttgcgccgggtgctgtggcggttcacggataa

DBGET integrated database retrieval system