KEGG   Synechocystis sp. PCC 6803: slr1311Help
Entry
slr1311           CDS       T00004                                 

Gene name
psbA2
Definition
(GenBank) photosystem II D1 protein
  KO
K02703  
photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Photosynthesis
Metabolic pathways
Module
Photosystem II
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    slr1311 (psbA2)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     slr1311 (psbA2)
Photosynthesis proteins [BR:syn00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    slr1311 (psbA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
7229..8311
Genome map
AA seq 360 aa AA seqDB search
MTTTLQQRESASLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDI
DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL
IGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGF
NFNQSILDSQGRVIGTWADVLNRANIGFEVMHERNAHNFPLDLASGEQAPVALTAPAVNG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgactctccaacagcgcgaaagcgcttccttgtgggaacagttttgtcagtgg
gtgacctctaccaacaaccggatttatgtcggttggttcggtaccttgatgatccccacc
ctcttaactgccaccacttgcttcatcattgccttcatcgccgctccccccgttgacatc
gacggtatccgtgagcccgttgctggttctttgctttacggtaacaacatcatctctggt
gctgttgtaccttcttccaacgctatcggtttgcacttctaccccatctgggaagccgct
tccttagatgagtggttgtacaacggtggtccttaccagttggtagtattccacttcctc
atcggcattttctgctacatgggtcgtcagtgggaactttcctaccgcttaggtatgcgt
ccttggatttgtgtggcttactctgcccccgtatccgctgccaccgccgtattcttgatc
taccccattggtcaaggctccttctctgatggtatgcccttgggtatttctggtaccttc
aacttcatgatcgtgttccaagctgagcacaacatcctgatgcaccccttccacatgtta
ggtgtggctggtgtattcggtggtagcttgttctccgccatgcacggttccttggtaacc
tcctccttggtgcgtgaaaccaccgaagttgaatcccagaactacggttacaaattcggt
caagaagaagaaacctacaacatcgttgccgcccacggctactttggtcggttgatcttc
caatatgcttctttcaacaacagccgttccttgcacttcttcttgggtgcttggcctgta
atcggcatctggttcactgctatgggtgtaagcaccatggcgttcaacctgaacggtttc
aacttcaaccagtccatcttggatagccaaggccgggtaatcggcacctgggctgatgta
ttgaaccgagccaacatcggttttgaagtaatgcacgaacgcaatgcccacaacttcccc
ctcgacttagcgtctggggagcaagctcctgtggctttgaccgctcctgctgtcaacggt
taa

DBGET integrated database retrieval system