KEGG   Synechocystis sp. PCC 6803: slr1426Help
Entry
slr1426           CDS       T00004                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    slr1426 (recR)
DNA repair and recombination proteins [BR:syn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      slr1426 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
Position
3283467..3284165
Genome map
AA seq 232 aa AA seqDB search
MGKVAVNSPAHRPLVSTAVYLAPSVKFPLQKRGLGTIYTPPLARLIEQLQRLPSVGPKTA
QRLALHLLKRPDAEVENLAQALLDAKKRVGQCQVCFHLSAEPVCDICRHPQRDNSVICVV
SDPRDVIALEKTREFRGKYHVLGGVISPMDGIGPEQLTIQPLLHRVSQPEIKEVILAISP
SVEGETTTLYLGKLLQPFTKVTRIAFGLPMGGDLEYADEVTLARALEGRREL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggctgtcaattcccctgcccacaggcccttggtttccacggctgtttac
ttggccccatcagtaaaatttcccctacaaaagagaggtcttggcactatttatactcct
cccctagcccgtctcattgaacaattgcaacggctccccagtgtggggccaaaaactgcc
caacgtcttgccctgcatctgcttaaacgtcctgatgcggaggtggagaatttggcccaa
gccctcctcgacgcaaaaaaacgggtggggcaatgccaagtatgcttccatttatccgct
gagcctgtctgtgatatttgccgccatccccaacgggataacagtgttatctgtgtggtc
agtgaccccagggatgtgattgcgctggaaaaaactagggaattccggggtaagtaccat
gtgttgggcggggtaatttcccccatggacggcatcggcccggagcaattgaccattcaa
cccctattacatcgggttagtcagccagaaatcaaagaagtaattttggctattagtcct
agtgtggagggggaaaccaccacgttatatttgggcaaactcctgcaaccttttaccaag
gttacccgcattgcctttggtttgcccatgggaggggatttggaatatgccgatgaagtt
accctggctagggccttggagggacggcgagaattgtaa

DBGET integrated database retrieval system