KEGG   Synechocystis sp. PCC 6803: slr1672Help
Entry
slr1672           CDS       T00004                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    slr1672 (glpK)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     slr1672 (glpK)
Exosome [BR:syn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   slr1672 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1952323..1953810
Genome map
AA seq 495 aa AA seqDB search
MTAKHNQYVMALDLGTTGNRAILFDYEGNIVGQAYKELTQFYPKAGWVEHDALEIWRDTK
TVMQEVVQKTAIQPQQIVAIGLTVQRETCLLWDKTTGQPLHPAIVWQDRRTAHFCGELTA
AGYVDEIYERTGLVLDAYFSGTKLHWLLDWVKQSKSVDPANLLAGTIDSWALWNLTGGKV
HRTDHSNASRTMVLNLDSLIWDEKLLDLFTIPAQIMPEVQPSLSYFGVTDPEILGVEIPI
TAIFGDQQAALYAHGCDRPGLLKCTYGTGAFLVANTGQTVTRSQHRLLSTVAWTQTNRDK
SLTRDYALEGSMFTAGSCVQWLRDKLGLIESAAASESLARSVDSNGGVYFVPALSGLGAP
HWDMNACGAFLGLTAGVTKAHLVRSVLEAIAFQAREVVEAINQDSPAPIQQLKVDGGACN
NDFLMQCQADVLGIPVERPAVLDATAQGAAFGAGLKIGWNQLQIRFFRTFHHGTISLICL
QFLPMRIQEGVSVDQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaacataatcagtatgtaatggccctggatttgggcaccaccggcaatcga
gctattttgtttgattacgaaggcaatattgtcgggcaagcttacaaagagttaacccag
ttctatcccaaggctggctgggtggagcacgatgccctggaaatctggcgggatacgaaa
acagtcatgcaggaagtggtgcaaaaaaccgctatccaaccccaacaaattgtggcgatc
ggtctaacggtgcaacgggaaacgtgtttgctctgggataagaccactggccaacccctc
catccggcaattgtctggcaggatcgacgcactgctcacttttgtggagaattaaccgcg
gcgggctacgtggacgaaatttatgagcgcaccggcctcgtgttagatgcctatttttcg
ggcaccaaactccattggttattggattgggttaaacagagtaagagtgtcgatccagct
aatctgttggcgggcaccattgatagctgggccctctggaacttaactgggggtaaagta
caccgcacggaccacagcaatgctagccgtactatggtgctcaatttagacagcctcatc
tgggatgaaaagctgttggatttattcaccattcccgcccagattatgccggaggtgcaa
cctagtttgagttacttcggcgttaccgacccggaaattctgggggtagaaattcccatt
accgccatttttggtgaccaacaggcggccctctatgcccacggctgcgatcgcccagga
ttgctgaaatgtacctacggcacgggggcttttttggtggcgaatacggggcaaacggta
acccgttcccaacatcgcttactttccactgtggcttggacccaaaccaaccgagacaaa
agcttgacaagggattacgccttggaaggaagtatgttcactgctggttcctgtgtgcaa
tggctacgggataagttgggtttaattgaatcagcggcggccagtgaaagcctagcccgc
agtgtggatagcaatggcggcgtttactttgtgccggccctaagtggtttgggggctccc
cattgggacatgaatgcctgtggcgcttttcttggcttaacagcaggggtaactaaagcc
catctagtcagatcggttctagaggcgatcgccttccaagcccgggaagtggtggaggcc
attaaccaggatagtcccgcccccattcaacaactgaaagtagatggaggagcctgtaac
aatgactttttgatgcaatgccaagcggatgttttaggcattcccgtagaacggcctgcg
gtgttggatgccacggcccagggagccgcctttggagccgggctaaaaattgggtggaat
cagcttcaaattaggtttttccgaaccttccaccacgggacgataagcttaatttgtctt
caatttctgcccatgcgtattcaggaaggtgtatccgttgaccagtga

DBGET integrated database retrieval system