KEGG   Synechocystis sp. PCC 6803: slr1706Help
Entry
slr1706           CDS       T00004                                 

Gene name
dfrA
Definition
dihydroflavonol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
syn  Synechocystis sp. PCC 6803
Brite
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     slr1706 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
733401..734432
Genome map
AA seq 343 aa AA seqDB search
MEVNHWIAMADCFFVTGGTGFVGANLVRHLLEQGYQVRALVRASSRPDNLQNLPIDWVVG
DLNDGDLHQQMQGCQGLFHVAAHYSLWQKDREALYRSNVLGTRNILACAQKAGIERTVYT
SSVAAIGVKGDGQRADESYQSPVEKLIGAYKQSKYWAEQEALTAAQQGQDIVIVNPSTPI
GPWDIKPTPTGEIILRFLRRQMPAYVNTGLNLIDVRDVAAGHLLAWQRGKTALTRGDRYI
LGHENISLQGILAHLSTITGLPAPKNTVPLWLPLTFAWVEEKVLAPLGRSPSVPMDGVKM
SAQEMYYDASKAVQELGLPQSSIKQALADAVHWFQNHGYVKTQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtcaatcactggatagccatggcggattgtttttttgtcactgggggcacgggc
tttgtcggggctaatttggtccgccatctgttggagcagggttatcaggtgcgggcgttg
gtgcgggcttccagccgtcccgataatttgcaaaatttacccatagattgggtcgtggga
gatttgaatgatggggatcttcaccaacaaatgcaaggctgtcagggtctcttccatgtg
gcggcccactattccctttggcaaaaagaccgggaagctctttaccgcagtaatgtttta
ggcacgagaaatatcctggcctgtgcccaaaaagcaggcattgaacgcactgtctacacc
agttccgtggcggcgatcggcgttaaaggggacggtcaaagggcggacgaaagttatcaa
agtccagtggaaaagttaattggagcctataaacagtccaaatattgggcggaacaggag
gcattgacagcggcccagcaaggccaagacattgtcattgttaatcccagcactcccatt
ggcccctgggatattaaacctactcccacgggagaaataattctgcgctttctgcggcga
caaatgccagcctacgttaacactggcttgaatttaatcgatgtgcgggatgtggcggcg
gggcatctcctggcttggcaacggggaaaaactgctctgaccagaggcgatcgctatatt
ttgggccatgaaaatatcagtcttcaagggattttggcccatctatctaccattacgggg
ttacccgccccgaaaaatacggttcccctttggttacccttgacctttgcctgggtggaa
gaaaaagttctggctcccctggggcgatcgccttcggtgcccatggatggggttaaaatg
tccgcccaggagatgtattacgatgctagtaaagcggtgcaggaattggggctaccccag
tcctctatcaaacaggctttggcagatgcggtgcattggttccaaaaccatggctacgtt
aagacccaataa

DBGET integrated database retrieval system