KEGG   Synechocystis sp. PCC 6803: slr1777Help
Entry
slr1777           CDS       T00004                                 

Gene name
chlD
Definition
Mg chelatase subunit ChlD
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
232008..234038
Genome map
AA seq 676 aa AA seqDB search
MTTLTPFIPLNFPITAIVGQEAIKLALLLGAIDPGLGGIVIAGRRGTAKSVMARAIHTLL
PPIEIIKGNRYQCDPKNPGSWDDDTLEKFADVPLDQLETQVIPAPFIQIPLGVTEDRLLG
SVDVEKSVKQGEAVFQPGLLAQAHRGVLYIDELNLLDDQIANQLLTVLTEGKNQIEREGM
SFQHPCQPLLIATYNPEEGPLRRHLLDRIAIALSADGILGLDQRVAAVDQVLAYADSPIS
FIDQYDAELDDLKTTIILAREWLKEVSLTPEQVSYLVEEAIRGGLQGHRGELFAMRVAKA
IAALDGRSDVQADDLRQAVELVIVPRSVLMDNPPPPEQAPPPPPPPQNQDEGKDEQEDQQ
DDKEDDKDNEPEAEQDPPSIPEEFIFDPEGVSLDPSVLYFAQMAQKQGKSGSRSVIFSDD
RGRYLKPILPKGKVRRIAVDATLRAASPYQKSRRLRHPDRQVIVEQGDIRGKKLVRKAGA
LIVFLVDASGSMALNRMQAAKGAVMQLLTEAYENRDQVSLIPFQGENAEVLLPPTRSIAM
AKKRLETLPCGGGSPLSHGLMQAVNVGMNAKRSGDIGQVVIVAITDGRGNIPLARSLGDE
IPEGEKPDIKAELLEIAAKIRGLGMQLLVINTEKKFVSTGFGKELAQKAGGKYYQLPKAT
DQGIASMARQAIADMQ
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctgaccccctttattcccctcaatttccccatcacggcgatcgtcggccaa
gaggcaatcaagctggctttactcctaggggcgatcgatcctggcttggggggcattgtt
attgccggacggcggggcacagccaaatcggtcatggctagggcaattcacactttgctc
cctcccattgaaatcattaagggcaaccgttaccaatgcgatccaaaaaatcccggcagt
tgggatgatgacaccctagaaaaatttgccgatgttcccctggatcaattggaaacccag
gtaattcccgctccctttattcaaattcccctgggggtcacggaggatcgcctgttggga
tcggtggatgtggaaaaatccgttaagcaaggggaagcggtgtttcagccgggattactg
gcccaggcccatcggggggtgctgtacattgacgagttgaatttactggatgaccagatt
gccaatcagttgctaacggtgttaacggaaggcaaaaaccagattgagcgggaaggcatg
agttttcagcatccctgccagcctttattaattgccacctataaccccgaagaagggccg
ttgcgtcgccatttattggaccgcattgcgatcgccttgagtgcggacggtattttgggg
ctggatcaacgggtagcggcggtggatcaggtgctagcctatgccgattctcccattagt
tttattgaccagtacgacgccgaattggacgacctaaaaaccaccatcattctggctcgg
gaatggctcaaggaagtgagtttaaccccggaacaggtgagttatctggtggaagaagca
atccggggcggcctccagggccatcggggagaattgtttgccatgcgggtagcgaaggcg
atcgccgctttggatggccgtagtgatgtgcaggctgatgatctgcggcaagcagtggaa
ttggtgattgtgccccgtagcgtgttgatggacaatcccccgcctccggaacaggctccc
cccccgccgccccctccccaaaatcaggatgaagggaaagacgagcaagaggatcaacag
gatgacaaggaagacgacaaagataatgaaccggaagcggaacaggatccccccagcatt
ccggaagaattcatttttgatcctgaaggagtaagccttgatccctcggtgctgtatttt
gcccagatggcccagaaacaaggtaaatccggcagtcgttccgtaattttttccgatgac
cggggccgttacctcaaaccgattttgcccaaaggaaaagtccgccgcattgctgtggat
gccacgttgcgggccgcttccccctaccaaaaatcccgtcgtttacgccatcccgatcgc
caggtaattgtggagcagggagatattcggggtaaaaagttagtgcggaaagccggggca
ttaattgtgtttttggtggatgcgtcgggttccatggcgttgaatcgtatgcaggccgcc
aaaggggcggtgatgcaattgctcacagaagcctacgaaaatcgagatcaggtttccctt
attcccttccagggagaaaatgccgaggtactattgccccccacccgttccattgccatg
gccaaaaaacggctggaaactttgccctgtggcggtggttctcccctttcccacggcttg
atgcaagcggtcaatgtgggtatgaatgctaaacgatccggggatattgggcaggtagta
attgtggccattaccgatggtcggggtaatattcccttggcccgttccctgggcgatgaa
attcccgaaggagaaaagcctgatatcaaagcggaattgttagaaattgccgccaagatt
cgcggtttagggatgcaattgttggtgatcaacaccgagaaaaaatttgtttccactggc
ttcggtaaagaattggcccaaaaagccgggggcaaatattatcaactccccaaagccact
gaccaaggtattgcctccatggcccgccaggcgatcgccgacatgcaatag

DBGET integrated database retrieval system