KEGG   Synechocystis sp. PCC 6803: slr2026Help
Entry
slr2026           CDS       T00004                                 

Gene name
folP
Definition
dihydropteroate pyrophosphorylase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    slr2026 (folP)
Enzymes [BR:syn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     slr2026 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
771651..772520
Genome map
AA seq 289 aa AA seqDB search
MDQLDQLSDYFPPPLPVGQTLFDWGKRTYVMGILNTTPDSFSDGGEFNSLPTAIHQAKTM
VQGGAHIIDIGGQSTRPGAETVSLKEELERTIPIIQALRQELDIPISIDTTRAEVARQAL
QAGADMVNDISGATFEPEILAVAAQHKAPIILMHIRGNPQTMQNLTDYGDLIGEMRQFFS
AQVDLARHYGVLPEQIILDPGIGFAKTAEQNITLLRQLPELKRLGFPLLVGPSRKSFIGK
ILDQPDPKERVWGTGATCCRAIAGGADIVRVHDVEAMAQICKVADALWR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaccagttggatcaattgagtgattattttccccctcccctcccggtgggccaaacc
ctttttgattggggcaaacgcacctatgtgatgggaattttgaatactacgccggacagt
tttagtgatgggggcgaatttaactctctaccaacggccatccaccaggctaaaaccatg
gtgcaggggggagcacacattattgacattggcggccagtccacccgaccgggggcagaa
actgttagcttgaaggaagaattagagcgcactattccgattatccaagctctccggcaa
gaattagacattcccatttccatcgataccaccagggcggaagtggcacgacaagctctc
caagccggagcggatatggtcaacgatatttccggagctacctttgaaccagaaattttg
gcggtcgccgcccagcacaaggctccgattattttgatgcacatacggggtaacccccaa
actatgcaaaatttgacggattatggggatttaatcggggaaatgaggcagtttttcagc
gcccaagtagatctagcccgccattacggcgtattgcccgaacagattatccttgaccca
ggcattggctttgctaaaaccgctgagcaaaatattaccctactgcgccagttaccggag
ctaaaaagacttggttttcccctattggtggggccatcccggaaaagtttcattggcaaa
attcttgaccaacctgatccgaaggaaagagtttggggtactggggcgacctgctgtcgg
gcgatcgccgggggagcagatatagtcagagtccatgatgtggaagccatggcccagata
tgtaaggttgcagatgccctatggcgatga

DBGET integrated database retrieval system