KEGG   Synechocystis sp. PCC 6803: slr2035Help
Entry
slr2035           CDS       T00004                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00330  Arginine and proline metabolism
syn00332  Carbapenem biosynthesis
syn01100  Metabolic pathways
syn01130  Biosynthesis of antibiotics
syn01230  Biosynthesis of amino acids
Module
syn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    slr2035 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    slr2035 (proB)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     slr2035 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: BAA17096
CyanoBase: slr2035
CYORF: slr2035
UniProt: P73071
Position
571440..572567
Genome map
AA seq 375 aa AA seqDB search
MTMAMQPQTLVIKIGTSSLARPETGQLALSTIAALVETVCKLIGQGHRVVLVSSGAIGVG
CSRLGLTERPKKMALKQAIAAVGQGRLMRTYDDLFSSLRQPIAQILLTRRELIERTAYVN
AYNTFQALFELGVIAIVNENDTVAIDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYS
SDPRLDPDAYPIPLVKAAELAQLQVRTDSTGSAWGTGGMATKITAARIATGSGVRTVITH
GQKPEQILAILQGANLGTQFEAQPRSDNARKRWIAYGLVPTGKIFIDAGAVQALKARGKS
LLAIGVVALEGEFSATDAVIICDPQGQELGRGLVNYNCNELEKIKGLHSEAIAAVLGYVG
PDTVIHRDNLVLQEN
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggcaatgcaaccccaaactttggtgattaaaattggtacttctagcctagct
cgtccggaaacgggtcagttggccctctccaccattgccgctttggtggaaactgtatgc
aagttgatcggccaaggccatcgggtggtgctagtctcctctggagccataggagtaggt
tgtagtcgtttgggcctgacagaaaggccaaaaaaaatggccttaaagcaggcgatcgcc
gctgtgggccagggcagattaatgcggacctatgacgacctttttagtagcctccggcaa
cccattgcccaaattttgctcaccagacgggaattaattgagcgtaccgcctatgtcaac
gcctacaacacgttccaagctctgtttgagttgggggtgattgccattgtcaatgaaaac
gacacggtggcgatcgatgaactaaaatttggcgacaatgatactttgtcggctttagtg
gccagcttggtggaagcggattggctatttttgctcactgacgttgaccgcctttattcc
agtgacccccgtttagatcccgatgcctatcccattcccctagtcaaagccgcggaatta
gcccaattacaagtccgcaccgatagcactggttccgcctggggcaccggcggcatggcc
accaaaatcaccgctgcccgcattgctacgggatcaggagtccgcaccgtcatcacccat
ggccaaaaacctgagcaaattttagccatcctccagggagctaatttgggcactcagttt
gaagcccaaccccgctccgataatgctcgtaaacgttggatcgcctatggtttagtgccc
accgggaaaattttcattgacgctggggcggtccaggccctcaaagctaggggcaaatcc
ctattggcgatcggggtggttgccctagaaggggaattcagtgccaccgatgccgtcata
atctgtgatccccagggtcaagaattagggcggggattagttaattacaactgtaacgag
ctagaaaaaattaagggactccattccgaggcgatcgccgcagtgttaggctacgtgggg
ccagatacagtgatccatcgagataatttagtattacaagaaaattag

DBGET integrated database retrieval system