KEGG   Synechocystis sp. PCC 6803: smr0006Help
Entry
smr0006           CDS       T00004                                 

Gene name
psbF
Definition
(GenBank) cytochrome b559 b subunit
  KO
K02708  
photosystem II cytochrome b559 subunit beta
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Photosynthesis
Metabolic pathways
Module
Photosystem II
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    smr0006 (psbF)
Photosynthesis proteins [BR:syn00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    smr0006 (psbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
570940..571074
Genome map
AA seq 44 aa AA seqDB search
MATQNPNQPVTYPIFTVRWLAVHTLAVPSVFFVGAIAAMQFIQR
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccaaaatcctaatcaaccggttacttatcccatttttacggtgcgctggctg
gcggttcacaccctggcggtgccctctgtcttctttgtcggggcgatcgccgcgatgcaa
tttattcaacgctag

DBGET integrated database retrieval system