KEGG   Synechococcus sp. PCC 6312: Syn6312_0368Help
Entry
Syn6312_0368      CDS       T02370                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syne00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
372172..372768
Genome map
AA seq 198 aa AA seqDB search
MMDSVVAVVGLGSNLGDSLSLANMAVESIATLPEVRLIACSRWYRTHPVGPPQPDYLNGC
LLLETTLSAPGLLTALQAIETQAQRQRPIHWGPRTLDLDLILYGASIINSPTLTVPHPYF
RERGFVLIPLVEIYPQGRDPVTGKTIAALAQEITPEGISLWPVADAPETSPGVVLDSLLP
EPPRSPPSDERLPDWWEY
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatggattctgtggtggcagtggtgggattggggagtaatttgggagattccctgagc
ctggcaaacatggcggttgaaagcattgccacgctacctgaagtgcgcctaatagcctgt
tctcgctggtatcgaactcacccggttgggccaccacagccggattatctaaatggctgt
ctgctgctggaaacaacattatctgccccaggcctgttaactgctctacaagcgattgaa
actcaggcccaacgtcagcggccgatccattggggcccacggacattggatttagactta
attctctatggcgcttcaatcattaacagtccaactctgacggttcctcatccctatttc
cgtgagcgggggtttgtcttgattcccttggtggagatttatccccaggggcgagatccg
gtcacaggtaaaacgatcgcagccttagcccaagagattactcctgagggaatttctctt
tggcccgttgccgatgctcccgaaaccagccctggagttgtgctcgacagtcttctccca
gaacccccccgatcacctccaagcgatgaaaggctgccggactggtgggaatattga

DBGET integrated database retrieval system