KEGG   Synechococcus sp. PCC 6312: Syn6312_0385Help
Entry
Syn6312_0385      CDS       T02370                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syn6312_0385
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syn6312_0385
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Syn6312_0385
Enzymes [BR:syne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Syn6312_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387217..388302
Genome map
AA seq 361 aa AA seqDB search
MTSTLTLPTAQAWQGLIHAYRSYLPVSDTTPIITLHEGNTPLIPVPRIAATIGRGVKVYV
KYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGLRAYVLIPE
GYVAQGKLAQALLYGAEVLAIQGNFDRALEIVREMAETYPITLVNSVNPYRLEGQKTAAF
EVVDALGDAPDWLCIPMGNAGNITAYWMGFCQYHEQNKGTRLPRMMGFQAAGSAPLVTGE
ICRHPETIATAIRIGNPANWQRALAVRAASQGDFQAVTDSEILVAYRMLAGEEGIFCEPA
SAASVAGLLKNQAQIPSGATIVCVLTGNGLKDPDTALQQETTQFHRNVVPELANVAGIMG
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgacctcgacgttgactttacccacagcccaggcctggcagggattaatccacgcttat
cggagctatttgccagtttccgacaccacgccaattattaccctccacgaaggcaacaca
cctctgattcccgtacctcggattgctgccaccattggccggggggtcaaagtctatgtc
aaatacgatggtcttaatcccactggcagcttcaaggatcgggggatgaccatggccatt
tccaaagctaaggaagcaggggccaaggcggtgatctgtgccagtacagggaacacctct
gctgctgctgctgcctatgcccgccggggagggttacgggcctatgtcctcattccagaa
ggctatgtagcccaaggtaaactagcccaggccctactctatggggcggaagtcttggcg
attcaggggaactttgaccgggccttagaaattgtccgagaaatggccgaaacctacccg
attaccctagtcaattctgtcaatccctatcgtttagaagggcaaaaaactgccgccttt
gaagtggtggatgctttgggggatgccccggattggctctgtatccccatggggaatgcg
ggaaatattacggcctattggatgggcttttgtcaatatcacgagcaaaacaaaggcaca
cgcttaccgcgaatgatgggctttcaagcggcgggttcggctcccctagtgaccggagaa
atttgtcgacatcccgaaaccattgctacggcgattcggattgggaatccagccaattgg
caacgggctttagcagtgcgcgccgccagtcaaggggactttcaggccgtgaccgatagc
gagattttagtggcctatcgcatgttggcaggagaagagggaattttctgcgaaccggcc
agtgcagcttcggtggcgggactcctgaaaaatcaggcccaaatccctagtggagccacg
attgtttgcgtcctcaccggtaatggcctcaaggatcccgatacggctttgcaacaagag
acgacccagtttcatcgtaatgttgtccccgaattggccaatgttgctggaattatgggg
ttttag

DBGET integrated database retrieval system