KEGG   Synechococcus sp. PCC 6312: Syn6312_0385Help
Entry
Syn6312_0385      CDS       T02370                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00260  Glycine, serine and threonine metabolism
syne00750  Vitamin B6 metabolism
syne01100  Metabolic pathways
syne01110  Biosynthesis of secondary metabolites
syne01120  Microbial metabolism in diverse environments
syne01230  Biosynthesis of amino acids
Module
syne_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syn6312_0385
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Syn6312_0385
Enzymes [BR:syne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Syn6312_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C TPR_14 TPR_4 TPR_16
Motif
Other DBs
NCBI-ProteinID: AFY59616
UniProt: K9RQ01
Position
387217..388302
Genome map
AA seq 361 aa AA seqDB search
MTSTLTLPTAQAWQGLIHAYRSYLPVSDTTPIITLHEGNTPLIPVPRIAATIGRGVKVYV
KYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGLRAYVLIPE
GYVAQGKLAQALLYGAEVLAIQGNFDRALEIVREMAETYPITLVNSVNPYRLEGQKTAAF
EVVDALGDAPDWLCIPMGNAGNITAYWMGFCQYHEQNKGTRLPRMMGFQAAGSAPLVTGE
ICRHPETIATAIRIGNPANWQRALAVRAASQGDFQAVTDSEILVAYRMLAGEEGIFCEPA
SAASVAGLLKNQAQIPSGATIVCVLTGNGLKDPDTALQQETTQFHRNVVPELANVAGIMG
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgacctcgacgttgactttacccacagcccaggcctggcagggattaatccacgcttat
cggagctatttgccagtttccgacaccacgccaattattaccctccacgaaggcaacaca
cctctgattcccgtacctcggattgctgccaccattggccggggggtcaaagtctatgtc
aaatacgatggtcttaatcccactggcagcttcaaggatcgggggatgaccatggccatt
tccaaagctaaggaagcaggggccaaggcggtgatctgtgccagtacagggaacacctct
gctgctgctgctgcctatgcccgccggggagggttacgggcctatgtcctcattccagaa
ggctatgtagcccaaggtaaactagcccaggccctactctatggggcggaagtcttggcg
attcaggggaactttgaccgggccttagaaattgtccgagaaatggccgaaacctacccg
attaccctagtcaattctgtcaatccctatcgtttagaagggcaaaaaactgccgccttt
gaagtggtggatgctttgggggatgccccggattggctctgtatccccatggggaatgcg
ggaaatattacggcctattggatgggcttttgtcaatatcacgagcaaaacaaaggcaca
cgcttaccgcgaatgatgggctttcaagcggcgggttcggctcccctagtgaccggagaa
atttgtcgacatcccgaaaccattgctacggcgattcggattgggaatccagccaattgg
caacgggctttagcagtgcgcgccgccagtcaaggggactttcaggccgtgaccgatagc
gagattttagtggcctatcgcatgttggcaggagaagagggaattttctgcgaaccggcc
agtgcagcttcggtggcgggactcctgaaaaatcaggcccaaatccctagtggagccacg
attgtttgcgtcctcaccggtaatggcctcaaggatcccgatacggctttgcaacaagag
acgacccagtttcatcgtaatgttgtccccgaattggccaatgttgctggaattatgggg
ttttag

DBGET integrated database retrieval system