KEGG   Synechococcus sp. PCC 6312: Syn6312_0385Help
Entry
Syn6312_0385      CDS       T02370                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syn6312_0385
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syn6312_0385
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Syn6312_0385
Enzymes [BR:syne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Syn6312_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387217..388302
Genome map
AA seq 361 aa AA seqDB search
MTSTLTLPTAQAWQGLIHAYRSYLPVSDTTPIITLHEGNTPLIPVPRIAATIGRGVKVYV
KYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGLRAYVLIPE
GYVAQGKLAQALLYGAEVLAIQGNFDRALEIVREMAETYPITLVNSVNPYRLEGQKTAAF
EVVDALGDAPDWLCIPMGNAGNITAYWMGFCQYHEQNKGTRLPRMMGFQAAGSAPLVTGE
ICRHPETIATAIRIGNPANWQRALAVRAASQGDFQAVTDSEILVAYRMLAGEEGIFCEPA
SAASVAGLLKNQAQIPSGATIVCVLTGNGLKDPDTALQQETTQFHRNVVPELANVAGIMG
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgacctcgacgttgactttacccacagcccaggcctggcagggattaatccacgcttat
cggagctatttgccagtttccgacaccacgccaattattaccctccacgaaggcaacaca
cctctgattcccgtacctcggattgctgccaccattggccggggggtcaaagtctatgtc
aaatacgatggtcttaatcccactggcagcttcaaggatcgggggatgaccatggccatt
tccaaagctaaggaagcaggggccaaggcggtgatctgtgccagtacagggaacacctct
gctgctgctgctgcctatgcccgccggggagggttacgggcctatgtcctcattccagaa
ggctatgtagcccaaggtaaactagcccaggccctactctatggggcggaagtcttggcg
attcaggggaactttgaccgggccttagaaattgtccgagaaatggccgaaacctacccg
attaccctagtcaattctgtcaatccctatcgtttagaagggcaaaaaactgccgccttt
gaagtggtggatgctttgggggatgccccggattggctctgtatccccatggggaatgcg
ggaaatattacggcctattggatgggcttttgtcaatatcacgagcaaaacaaaggcaca
cgcttaccgcgaatgatgggctttcaagcggcgggttcggctcccctagtgaccggagaa
atttgtcgacatcccgaaaccattgctacggcgattcggattgggaatccagccaattgg
caacgggctttagcagtgcgcgccgccagtcaaggggactttcaggccgtgaccgatagc
gagattttagtggcctatcgcatgttggcaggagaagagggaattttctgcgaaccggcc
agtgcagcttcggtggcgggactcctgaaaaatcaggcccaaatccctagtggagccacg
attgtttgcgtcctcaccggtaatggcctcaaggatcccgatacggctttgcaacaagag
acgacccagtttcatcgtaatgttgtccccgaattggccaatgttgctggaattatgggg
ttttag

DBGET integrated database retrieval system