KEGG   Synechococcus sp. PCC 6312: Syn6312_0526Help
Entry
Syn6312_0526      CDS       T02370                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00240  Pyrimidine metabolism
syne00250  Alanine, aspartate and glutamate metabolism
syne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Syn6312_0526
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Syn6312_0526
Enzymes [BR:syne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Syn6312_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431
Motif
Other DBs
NCBI-ProteinID: AFY59752
UniProt: K9RRN3
Position
complement(530617..531591)
Genome map
AA seq 324 aa AA seqDB search
MSLPTSWHRRHILSLSDFGLEELNTVLKTAQSFQEVLSRRTKKVPTLQARVVANLFFEAS
TRTRNSFELAAKRLSADILNFAPGTSALSKGETILDTAKTFWAMGTEFMVIRHQQSGVPA
TIAAEMDRLGGQVGVLNAGDGCHEHPSQALLDLFTLSTLLNPENPQAGSLAGKKVAIVGD
VLHSRVARSNLYSLKTAGAEIHLAGPPTLLPKSFANYGAKIHWQLEPALENADFVMTLRL
QKERMEQQLIPSLREYHQTYGITHQRLKLCHPDVKVLHPGPVNRGVEISSALMDDPGFSL
IQNQVTSGVAVRMALLYLMGSHGQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaccgaccagttggcatcgccgccatattctttctctgtctgactttggcctg
gaggaactcaataccgtccttaagactgcccagagtttccaagaagtcctcagccgtcgc
actaaaaaagtcccgacactccaggccagggtggttgccaatcttttttttgaagcctcg
acccgcacccgcaacagttttgagctggccgccaaacgcctctccgccgatattctcaac
tttgcccctgggacttccgcgctgagtaaaggggaaaccattctcgatacggccaaaacc
ttctgggcgatgggaactgaatttatggtcatccgccatcaacaatcgggggttccggca
actattgcggctgagatggatcgtctaggcggtcaagtaggtgtgctgaatgcgggagac
ggttgccatgaacatccttcccaggccctgttggatttattcacactctcgaccctcctc
aacccagaaaacccccaggccgggagtctcgcaggaaaaaaagttgccattgtcggggat
gtgctccattcacgggtagcgcgctccaatctctatagcctcaaaaccgccggagctgaa
atccatctagccgggccacccacgctcctcccgaaaagctttgccaactatggagccaaa
attcactggcagttggaacccgccctcgaaaatgctgattttgtcatgaccctgcgcctc
caaaaagagcggatggagcagcaactcatcccgagtttgcgcgaataccaccagacctat
ggcatcacccaccaacgtctgaaactctgccacccggatgtgaaagtgctgcacccaggc
cctgtgaatcgtggtgttgaaattagctcagcgttgatggatgaccccggatttagcctg
attcaaaaccaagttaccagtggcgtggccgtgcggatggccttgttatacctgatgggc
agtcatgggcaatag

DBGET integrated database retrieval system