KEGG   Synechococcus sp. PCC 6312: Syn6312_0622Help
Entry
Syn6312_0622      CDS       T02370                                 

Definition
fatty-acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Syn6312_0622
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Syn6312_0622
Enzymes [BR:syne01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Syn6312_0622
Lipid biosynthesis proteins [BR:syne01004]
 Desaturase
  First
   Syn6312_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622424..623278
Genome map
AA seq 284 aa AA seqDB search
MTAAQELPPQNLKPAWKTIFFMALVHLGALCALIPGTFSWSGLAVGGVLFWLTGGLGITL
GWHRLLTHRSFQLPKFLEYFFAFCGALACEGGVIEWVGLHRNHHLHSDHEQDQHNSRRGF
WWSHMGWMLSEIPAKVEIDRLTKDINQDPVYRFLDDHFILIQVAFGLVLYALGGWSWVIW
GIFVRLVAVYHVTWFVNSATHQFGYRTFETDDYSTNCWWVALLAFGEGWHNNHHTYPHSA
RHGLQWWEFDLTWQTIRLLKGLGLAKKVRLVTATGGMAGEPVED
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgcccaagaattaccaccacaaaacttaaaaccggcctggaaaacgattttt
ttcatggcgttggtgcatttgggggccttgtgcgccttaattcctggcacctttagttgg
tcaggcttagccgttggcggagttttattttggctgactgggggcctgggaattacctta
ggctggcatcgcctcttgacccatcggagttttcaattacccaaatttttagaatatttc
tttgccttttgtggggccttggcctgtgaagggggcgtgatcgaatgggtgggtctgcat
cggaaccatcatctccactcggatcatgaacaggatcaacataattctcggcgcgggttt
tggtggagccacatgggttggatgctctcagaaatcccagccaaggtagaaattgaccgc
ctgacgaaagatattaatcaagacccggtttatcgcttcttagatgatcactttatcttg
atccaagtcgcctttggcctggtgttgtatgcccttgggggatggtcttgggtcatctgg
ggaatttttgtccgtctcgtggcggtgtaccatgtcacttggtttgtcaacagtgccacc
catcaatttggttatcgcacctttgaaactgatgactactcgaccaactgctggtgggtg
gcccttttggcctttggcgagggctggcacaataaccatcacacctacccccactccgcc
cgacatgggttgcaatggtgggaattcgacctaacttggcagacgattcgcctcttaaag
ggcttgggcttagctaaaaaagtccgcttggtcacggcaactggggggatggcgggggag
ccagttgaagactga

DBGET integrated database retrieval system