KEGG   Synechococcus sp. PCC 6312: Syn6312_0775Help
Entry
Syn6312_0775      CDS       T02370                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syne00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(773240..774334)
Genome map
AA seq 364 aa AA seqDB search
MEKPHFVEATPVTATALTRRPVFPFTAIVGQEEMKLSLLLNVIDPKIGGVMIMGDRGTGK
STTIRALADLLPAIEVVANDPFNSSPTDADLMSDEVKLAIAAGQELPIISQKVTMVDLPL
GATEDRVCGTIDIEKALGEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASG
WNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPSLRVEIVEQR
TQFDQDPEGFLNQHRAEQENLQAQIIVAQARLPHVTLDHELRVQISQVCSYLDVDGLRGD
IVTNRAAKAIAALEGHQDVTVDDIRRVIVLCLRHRLRKDPLASIDSGDRVAQVFGEVFGV
ELAA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccccattttgttgaagcaacgcctgtgactgccactgccttgacccgccgt
ccggtttttccctttacagctattgttgggcaagaggaaatgaaactctccctccttttg
aatgtcattgacccaaaaattggcggggtgatgatcatgggcgatcggggcacgggcaaa
tccacaaccattcgcgccctagcagaccttctcccggccattgaagtagtcgccaatgat
ccctttaatagcagccccaccgatgcggatttgatgagcgatgaggtgaagttagccatt
gccgccggtcaagagctacccattattagccaaaaggtgacgatggtggatttacctttg
ggggccacggaagatcgggtttgcggcacgattgatattgagaaagccctcggtgaaggg
gttaaggcctttgaaccgggcctactggccaaagcgaatcggggaattctctatgtggat
gaagtgaacttgctggatgatcacctggttgatgtgttgctagattcggcggcctctggt
tggaatacggtggagcgggaaggcatttcgattcggcatccggcccgatttgtcttggtg
ggatcgggaaatccagaagagggagaactccggccacagttgttggatcggttcgggatg
cacgcggaaattcgcaccgttaaggatcccagtttgcgggtagaaattgtcgaacaacgt
acccagtttgatcaagatccggaaggcttcttaaatcaacatcgggccgagcaagaaaac
ctccaggcccagattattgtcgcccaggcccgtctgccccatgtcaccctcgaccatgaa
ctgcgcgtccagatttcccaggtatgctcctacttggatgtggatggcttgcggggagat
attgtcaccaatcgggccgccaaggccattgccgcattggaaggccatcaggatgtcact
gtagatgatattcgccgagtaattgtcctgtgtttacggcatcgtttacgcaaagatccc
ctcgcttcgattgattctggggatcgggtggcccaagtgtttggggaagtgtttggggtt
gaactagcggcttag

DBGET integrated database retrieval system