KEGG   Synechococcus sp. PCC 6312: Syn6312_0775Help
Entry
Syn6312_0775      CDS       T02370                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Syn6312_0775
Enzymes [BR:syne01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Syn6312_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(773240..774334)
Genome map
AA seq 364 aa AA seqDB search
MEKPHFVEATPVTATALTRRPVFPFTAIVGQEEMKLSLLLNVIDPKIGGVMIMGDRGTGK
STTIRALADLLPAIEVVANDPFNSSPTDADLMSDEVKLAIAAGQELPIISQKVTMVDLPL
GATEDRVCGTIDIEKALGEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASG
WNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPSLRVEIVEQR
TQFDQDPEGFLNQHRAEQENLQAQIIVAQARLPHVTLDHELRVQISQVCSYLDVDGLRGD
IVTNRAAKAIAALEGHQDVTVDDIRRVIVLCLRHRLRKDPLASIDSGDRVAQVFGEVFGV
ELAA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccccattttgttgaagcaacgcctgtgactgccactgccttgacccgccgt
ccggtttttccctttacagctattgttgggcaagaggaaatgaaactctccctccttttg
aatgtcattgacccaaaaattggcggggtgatgatcatgggcgatcggggcacgggcaaa
tccacaaccattcgcgccctagcagaccttctcccggccattgaagtagtcgccaatgat
ccctttaatagcagccccaccgatgcggatttgatgagcgatgaggtgaagttagccatt
gccgccggtcaagagctacccattattagccaaaaggtgacgatggtggatttacctttg
ggggccacggaagatcgggtttgcggcacgattgatattgagaaagccctcggtgaaggg
gttaaggcctttgaaccgggcctactggccaaagcgaatcggggaattctctatgtggat
gaagtgaacttgctggatgatcacctggttgatgtgttgctagattcggcggcctctggt
tggaatacggtggagcgggaaggcatttcgattcggcatccggcccgatttgtcttggtg
ggatcgggaaatccagaagagggagaactccggccacagttgttggatcggttcgggatg
cacgcggaaattcgcaccgttaaggatcccagtttgcgggtagaaattgtcgaacaacgt
acccagtttgatcaagatccggaaggcttcttaaatcaacatcgggccgagcaagaaaac
ctccaggcccagattattgtcgcccaggcccgtctgccccatgtcaccctcgaccatgaa
ctgcgcgtccagatttcccaggtatgctcctacttggatgtggatggcttgcggggagat
attgtcaccaatcgggccgccaaggccattgccgcattggaaggccatcaggatgtcact
gtagatgatattcgccgagtaattgtcctgtgtttacggcatcgtttacgcaaagatccc
ctcgcttcgattgattctggggatcgggtggcccaagtgtttggggaagtgtttggggtt
gaactagcggcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system