KEGG   Synechococcus sp. PCC 6312: Syn6312_0810Help
Entry
Syn6312_0810      CDS       T02370                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
syne  Synechococcus sp. PCC 6312
Brite
Enzymes [BR:syne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Syn6312_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(808902..809678)
Genome map
AA seq 258 aa AA seqDB search
MGMFTSQLRNEPFFLPGRDLNRACLMLHGLGAGTYELQILAEHLHQQGNTVKAILYPGHD
QPQANMPNSTWQQWYKAVETAYLGLKETYSEIDVIGFSTGCPLGLYLASHYRIRKLVCLC
PYLSLKQPPYSPVPLESLIKSVGYLLPQVPRLDLPFRDPTLKAQVNRVKFYKTFNLVAVR
SAMELIETVKPLIPEITVPTLIIQARHDTVVNPQGAVYLYETLGATIKKLAWCENSDHIV
TLDYDRDQVAAEVTAFLN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgtttaccagccagttaaggaatgaaccgttttttctgccaggtcgcgatctc
aaccgagcctgtttaatgctccatggcctgggggctggaacctatgaactgcaaatcctg
gcggaacatctgcatcaacaagggaacaccgtcaaagctattctctatcccggccatgat
cagccccaagccaatatgcccaactccacctggcaacagtggtacaaagcggtagaaacg
gcctatttagggttaaaagagacctactcggaaattgatgtgattggcttttccacaggc
tgccccttggggttatatctagcgagtcattatcggatccggaaattagtctgtctgtgt
ccatatctgtccttaaaacaacctccgtattctccagttcctttggaatctctgatcaaa
tccgttggctatctcctaccccaagttccccgtctcgacttacctttccgagacccaact
ttgaaagcacaggttaatcgagtgaagttttataagacatttaacttggttgcggttcgc
agtgcaatggagctaattgagacagtcaagcccttgattccagaaattactgtaccgaca
ctgattatccaggcccgccatgatacggttgtgaatcctcaaggagcggtttacctctat
gaaacgctgggggcaacaatcaaaaaactggcctggtgcgaaaattctgatcacattgtt
actcttgactatgatcgcgaccaagttgctgcggaagtgactgcattcttgaactag

DBGET integrated database retrieval system