KEGG   Synechococcus sp. PCC 6312: Syn6312_0912Help
Entry
Syn6312_0912      CDS       T02370                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syne00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syn6312_0912
Enzymes [BR:syne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Syn6312_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
901679..903901
Genome map
AA seq 740 aa AA seqDB search
MVVVTRNHHGMASPTVEEIQGTVERVTFHSPDSGYTIARLDVKGYQELVTIIGSFPQLQA
GTTIRLWGQWREYPKYGSQLQVQRYEELKPATLNGIEKYLGSGLIKGVGQKTARKIVNHF
GLETLEIIESQVDRLIEVPGLGERRVKQIQGAWNDQRTIRDVMVFLQGHGVSPTHAVKIF
KQYGEQSVTVVTDNPYRLATDIYGIGFVTADAIARKIGITPNSEYRYQAGIRHVLDTAGE
DGHCFLPLSQLVSTVIERLTLDDHVPKADQVEFLLNEMVRGKQIMRAEVNGEGVYYAPPF
YRAEMGLAKAIQALTASSVSVDMERVDNWLRRYSERVGLPLAPKQLEAVRQAVSQRLLIL
TGGPGTGKTFTTRTIATLWRAMGKKVLLASPTGRAAQRLSEVTGQEAITLHRLLEFSPKS
MQFQRNEDNPLEADAVIVDEVSMLDLFLAYSLMRAIPLTVQVLLVGDADQLPSVGAGAVL
RDLINSQAVPVVRLTEVFRQAQTSAIVTEAHRINQGQYPKLEPMSDTPESDCLWHGAEEA
EQGVIAITSIVSEFIPTLGFDPRRDVQVLCPMTRSVVGTRNLNAVLQSVLNPSDLTKPAL
QRGGQILRVGDRVLQRVNDYDRDVFNGDLGWIEAIDPEEQETTVCFGNRSVTYDWADLDE
ITLAWPCTIHKSQGSEFPVVILPMYMQHYLMLSRNLLYTGLTRARKLAILVGPKKAIGLA
VRETKDKLRFTRLKELLITP
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtggttgtcgtcacccgcaaccatcacggtatggcctccccaacagtcgaagaaatccaa
ggcacagtagagcgagttacctttcactcaccggatagtgggtacaccatagctcggctc
gatgtgaaggggtatcaagagctagtcactatcattggcagctttccacaacttcaggca
ggaaccaccatccgactctgggggcagtggcgagagtatcccaagtacggctcccaactc
caggtgcaacgatatgaagaactgaagcccgccaccctcaacggcatcgaaaaatatttg
ggcagtggcttgattaagggagttggacagaaaaccgctcgcaaaatcgtcaaccacttc
gggctagaaaccctagaaatcattgaaagtcaagttgaccgattaattgaagtccctggc
ctgggtgaaagacgggtcaagcaaatccaaggggcctggaatgaccagcggacaattcga
gatgtcatggttttcttacagggccatggggtgagtcccacccatgccgtcaaaatcttc
aagcagtatggggagcagtcagtcacggtcgtcactgacaacccctatcggctggcgacc
gacatctacggcattggctttgtcaccgctgatgccattgcccgcaagattgggattacc
ccgaacagcgagtatcgctaccaggccgggattcgtcatgtcttagatacggcgggagaa
gacgggcattgcttcttacccctcagccaacttgtcagcaccgtgattgaacgcctcacc
ctggatgaccacgttcctaaggcagaccaggttgaatttctgctcaatgaaatggtcaga
gggaaacagatcatgcgagccgaggtgaacggagaaggagtctattatgcgccccccttc
taccgagccgagatgggattagccaaagcgattcaagccttgactgccagcagcgtcagt
gtggatatggaacgagtcgataactggctgaggcgatacagcgagcgggtgggactgccc
ctggccccgaagcaactcgaagcggtgcgccaagccgtgagtcaacgactacttatcctc
acaggtgggccaggcacaggtaaaaccttcaccacccgcacgattgccaccctctggcgg
gccatgggcaaaaaggtattactcgcttcccccacgggacgggccgcccaacgtctgagt
gaagtcaccggacaagaggcgattacgttgcaccggctcctagagttttcgcccaagagc
atgcagttccaacggaatgaggataaccccttagaggctgatgccgtcattgtggatgag
gtctcgatgttagacctgttcttggcctacagcttgatgcgagccattcccttaacagtc
caagtccttctagttggggatgcagaccaactacccagcgtgggagcaggagccgtctta
cgagatttgattaactctcaagccgtaccagtcgtccgactgactgaagtcttccgtcag
gcccagaccagtgccattgtcacggaagcccaccggatcaaccaggggcagtatcctaag
ctggagccgatgtcagatacgccagagtcagactgcctgtggcatggggcagaagaagcc
gagcaaggcgtgattgccatcaccagcatcgtctcggagtttatccccaccctgggcttt
gaccccagacgagatgtgcaagttctctgcccaatgacccgcagtgttgtgggtactcgc
aacctcaatgctgtacttcagtcggtgctgaacccgtcagacctaacgaagcctgcactt
caacggggcgggcaaatcttacgggttggcgaccgagtcttgcagcgagtgaatgactat
gaccgtgacgtattcaacggcgacctgggctggattgaggcgattgacccggaggaacaa
gaaaccaccgtctgctttggtaatcgttctgtcacctatgactgggcagacctcgatgaa
attaccttggcctggccctgcacgatccacaagtcccaagggagtgagtttccggttgtg
attctgccgatgtatatgcagcactatctgatgctctcccgcaacttgctttacacagga
ctgaccagggccaggaagctggcgatcttagttggccccaaaaaagcaatcgggctggca
gtccgagaaacgaaagacaagctccggtttactcgcctcaaggaattactgataacacct
taa

DBGET integrated database retrieval system