KEGG   Synechococcus sp. PCC 6312: Syn6312_1017Help
Entry
Syn6312_1017      CDS       T02370                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syn6312_1017
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syn6312_1017
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Syn6312_1017
Enzymes [BR:syne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Syn6312_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(995927..997225)
Genome map
AA seq 432 aa AA seqDB search
MTATITAPSRQANFTGLKCKECGAEYEAQAIHVCEYCFGPLEVKYDLSQLAKTVTRQTIE
AGPNSIWRYRSFLPVETNTPIDVGTGMTPLLKANRLARQLGLKHLYIKNDAVNMPTLSFK
DRVVSVALTRAQELGFTTVSCASTGNLANSTAAIAARAGLDCCVFIPSDLEAGKVLGTLI
YGPTVMAVQGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVIEQLGWELPD
HIVAPLASGSLFTKIYKGFREFVEVGLVADKAVRCSGAQALGCSPIASAFGEGRDFINPV
KPSTIAKSIAIGNPADGVYALDIARKTNGNIESVNDDEIIAGIKLLAETEGIFTETAGGT
TVAVLKKLVEAGKIDPEEKTVIYITGNGLKTQEAVQGYIGEPLTIEPKLDAFERALERSR
TLERLEWQPVLV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccatcaccgcccccagccgccaagccaacttcactggacttaaatgtaag
gaatgtggagccgaatatgaagcccaggccattcatgtttgtgaatattgttttggcccc
ttagaagttaaatatgacctcagccaattggctaaaaccgtcactcgccaaaccattgaa
gcggggcccaattctatttggcgataccgcagctttttaccggtagaaacgaataccccc
attgatgtgggtacgggcatgactcccctgttaaaagccaatcggttagcgcggcaattg
ggtctgaagcatctctacatcaaaaatgacgcggtgaatatgcccaccttgagctttaag
gatcgggtcgtatccgttgctctaactcgggcccaagaactcggcttcacgacggtttcc
tgtgctagcactggcaatttagccaactcgacagcagcaattgcggcccgggcggggtta
gattgttgtgtgtttattccctcggatttggaagcagggaaagtcctaggaaccctgatc
tatggccccacggtgatggcggtgcagggaaattatgatcaggtgaatcggctctgctca
gaagtggcgaatacccacggttgggggtttgtgaatatcaatttgcgtccctactattca
gaaggctccaaaacccttggctatgaagtgattgagcagttgggctgggaattaccggat
cacattgtggctcccctggcttctggctccctgtttaccaagatttataaaggcttccgg
gaatttgttgaagttggtttagtggccgataaagcggttcgctgtagtggcgcccaggcc
ttgggatgttccccgattgcctctgcctttggtgaaggtcgcgactttatcaacccggtc
aaacccagcaccattgccaaatccattgcgatcggaaaccctgctgatggcgtttatgcc
ttagatattgcgcggaagaccaatggcaatattgagtccgtcaatgatgatgaaattatc
gccggaattaagctcttagccgaaaccgaaggcatcttcaccgaaaccgcaggcggaacc
accgttgctgtcctgaaaaaactcgtggaagcgggcaaaattgacccggaagaaaaaacc
gtgatttacatcactggcaatggcctgaaaacccaagaagcggttcaaggttatattggt
gaacccctgaccattgagccaaaactagatgcctttgaacgggctttagagcggtcacgt
accctagaacgcttagaatggcagccggttttggtttag

DBGET integrated database retrieval system