KEGG   Synechococcus sp. PCC 6312: Syn6312_1050Help
Entry
Syn6312_1050      CDS       T02370                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
syne00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Syn6312_1050
Enzymes [BR:syne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Syn6312_1050
Transporters [BR:syne02000]
 Other Transporters
  Pores ion channels [TC:1]
   Syn6312_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AFY60244
UniProt: K9RSI0
Position
complement(1027472..1028026)
Genome map
AA seq 184 aa AA seqDB search
MIQLYGGRQTRAAIVHWYLEELGIPYEFVVMDMKAGAHKQADFLAINPMGKVPALVDGNL
KLWESGAILLYLADSQGKMPEDAGLRGLIYQWVLFANSSLPQAMTGEAKETQLPKLLAAV
DGALLGNEFLVADTFTVADVAMASTLSYAEMLFQIDFSPYSAVQSYLGGMTQRPAFRKGI
MGQD
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgattcaactatatggcggcagacaaacccgggcagcaattgtccactggtatctagag
gaactggggattccctacgaatttgtcgtcatggacatgaaagctggggcccacaaacaa
gcggatttcttggccattaacccaatggggaaagtccccgccctagtggatggaaaccta
aagctatgggaatctggggcaattttactctaccttgccgattctcaaggaaaaatgcca
gaggatgccgggttgcgggggctaatttaccaatgggtgctttttgctaattccagtttg
ccccaggccatgacgggagaagcaaaagaaactcaactgcccaagctcctggctgctgta
gatggggcactgttggggaacgaatttttagtggctgacaccttcaccgtggctgatgtg
gcaatggctagtacccttagttatgctgagatgctctttcagatagatttttctccctat
tcggcagttcaatcctacttgggggggatgactcagcgaccagcatttcggaaagggatt
atggggcaagactaa

DBGET integrated database retrieval system