KEGG   Synechococcus sp. PCC 6312: Syn6312_1275Help
Entry
Syn6312_1275      CDS       T02370                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Syn6312_1275
Enzymes [BR:syne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Syn6312_1275
Exosome [BR:syne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Syn6312_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1241292..1242947)
Genome map
AA seq 551 aa AA seqDB search
MTHPIEFQLFAPYNKAVALIGSFSAWEDIPMQQGEDGYFRAQVELEDGTYHYKFRVQSKS
WFVEPDQWLEVVDPYATDIDNSTQNGVVQIKNGKKIVDTYIWKHDDKPLPSDRELVIYEL
HVADFSGGEPDRYVRGKYKHVVEKLDFLADLGINAIELMPLKEYPGDYSWGYNPRYFFAA
ESSYGSTDELKNLIDECHARGIRVIMDGIYNHSESSSPLTQIDHDYWYHHSPRDPDNNWG
PEFNYDFYDENLDVKPAWTFIGDVVRYWIEEYHVDGIRYDAARQIANYDFMHWIVAETKK
TAGVKPFYNIAEHIPETTSITNVDGPMDGCWHDSFRSVITGHICGDMFDIEQLKDVIDCK
RKGFMGTTNVVNYLTNHDHNHILAELGNRNIFNDEAFKRAKLGAAILMTAVGVPLIWMGE
EFGEYKHNTQEQAKVEWALLDNDLNGELFEYYKGLIHLRKNNQALYVENIDFFHEDPNSQ
VLAYTRWNEEGSRVVVVANFSGNFWAGYTVPHFPANGTWHEWTGDYDVESGADNMMIDLA
EYEAKVFVWQG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacacacccgattgaatttcaattatttgccccctacaacaaagcagtcgccttgatt
gggtcattctcggcctgggaagatattccaatgcaacaaggagaagatggctatttccgc
gctcaagttgagctggaggatggcacctatcactataaattccgggttcagtcaaaaagc
tggtttgtcgagccggatcaatggttagaggttgttgacccctatgccacagatattgat
aattcgactcaaaatggggttgtccaaatcaaaaatggcaaaaaaattgttgatacctac
atttggaaacatgacgataaacccttgcccagcgatcgcgagttagtcatttatgaactg
cacgtggctgacttttctgggggcgaaccagaccgctatgtgcgcggtaaatataaacac
gttgtcgaaaagttagattttcttgctgacctgggtattaatgccattgaactgatgccg
ctcaaagaatatccgggggattatagctgggggtataacccgcgttacttttttgctgca
gaatcaagttacggctcaacggacgagttaaaaaatctgattgatgaatgtcacgcccgc
gggattcgggtcatcatggatgggatttacaatcactcagaatcgtctagtcccctgaca
caaattgaccatgattactggtaccatcattctccccgggatcctgataacaactggggg
ccagaatttaattatgacttttatgatgaaaacctagatgttaaaccggcctggacattc
attggtgatgttgttcgctattggattgaagaatatcatgtggatggcattcgctacgat
gcagcccggcaaattgctaattatgactttatgcattggatcgttgccgaaactaaaaaa
acagccggagttaagccattttataacattgccgaacatattccagagacaactagtatc
acaaatgtcgatggcccgatggatgggtgctggcacgatagttttcgttctgtaattacc
ggccacatctgcggcgatatgtttgatatcgaacagcttaaggatgtgattgactgcaag
cgaaaagggtttatggggacaactaatgttgttaattatctaaccaatcacgaccacaat
catatcctggcagaattgggcaatcgaaatatctttaatgatgaagcctttaagcgagcg
aagttgggtgcggcgatcctgatgacggcggtgggtgtgcccttgatttggatgggagaa
gaatttggtgagtataaacataacacccaagagcaagcaaaagttgaatgggcactgtta
gataatgatctaaatggggaattgtttgaatactataaagggctgattcatctgcggaaa
aacaatcaggctttgtatgtggaaaatattgacttttttcacgaagatcctaactcacaa
gtgcttgcttacacgcgctggaatgaggaaggctcacgggttgttgttgttgctaatttt
tcgggtaacttctgggctggctataccgttcctcacttcccagccaatggaacctggcac
gaatggacaggcgattatgatgttgagtctggggccgacaacatgatgattgacttggca
gaatacgaagccaaagtgtttgtctggcagggctaa

DBGET integrated database retrieval system