KEGG   Synechococcus sp. PCC 6312: Syn6312_1326Help
Entry
Syn6312_1326      CDS       T02370                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:syne00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301197..1302135
Genome map
AA seq 312 aa AA seqDB search
MYCLIAPAKINLFLQIVGSYLPDPRYHELVMVMQAVTLADGINLTPLSQEVIVLTCDHPQ
VPTNSMNLAYKAAALMQSQFPGHGGVEIHIDKRIPIGAGLAGGSTDAAAVLVGLDLLWDL
GLTQGELQGLGGQLGADVPFCIGGGTALALGRGDDLTPLPDLDHVVLLLGKFTNISVSTP
WAYQTYRQTYGASYAQTVAQQEQKRQQDGSRELLQALSQKNIPTLAQALHNDFEAIVLPE
YPLVAQLRQAFIDAGAMAAMMSGSGPTVFAIAESQVQAEMIKTQVQGQFADQGLDIWLAQ
TCPHGVRLVAQA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgtattgtctgattgcccctgccaaaattaatctgtttttgcaaattgtgggttcctat
ctcccagacccccgctatcatgaactcgtcatggtgatgcaggctgtaaccttggcggat
ggcattaacctcacccccctgtctcaagaagtgattgttctcacctgcgatcatccccaa
gtcccgactaactcgatgaatttagcctacaaagctgcggccctgatgcaatcccagttt
cccggccacgggggggttgagattcatattgataaacgaattccgattggggctggcctg
gcgggggggtcaacggatgcagcggcggttttggtaggtctggatcttctgtgggattta
ggcttaacccaaggtgaattacaaggcctgggtgggcagttgggggccgatgtcccattc
tgtattggtggaggtacagccttggccttgggtcggggggatgatcttacacccttgccg
gatttagaccatgtggtgctattactgggcaagttcaccaacatcagtgtttcgacaccc
tgggcctatcaaacctatcgccagacctatggagctagttatgcccagacagtagcccag
caggaacaaaaacgacaacaagacggctctcgggaactcctccaggccctgagtcagaaa
aacattcccaccttggcccaggctctccataacgattttgaagcgattgttttgcctgaa
tatcccttagttgcccaattacgccaggcctttattgacgctggggccatggccgcaatg
atgtccggttcggggccgaccgtttttgccattgccgaatctcaagtccaagccgaaatg
atcaaaactcaggtacaagggcaatttgcggatcagggcctggatatttggctggctcag
acttgtccccatggggtgcggttggtcgcccaggcctaa

DBGET integrated database retrieval system