KEGG   Synechococcus sp. PCC 6312: Syn6312_1440Help
Entry
Syn6312_1440      CDS       T02370                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syn6312_1440
  Amino acid metabolism
   00340 Histidine metabolism
    Syn6312_1440
Enzymes [BR:syne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Syn6312_1440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1415386..1416705)
Genome map
AA seq 439 aa AA seqDB search
MGIMLRILNCLEDIRSELRRICDRIHDDQVIHKEATVQQILQTVQRQKDLALIHYTAEFD
HVELTVDSLRVSGAELDAAYQQVSKELLDAIRLAHQQIKAFHEQRIPKNWIQFPAEGVVL
GKRYTPVDAAGLYIPGGRAAYPSTVLMNAIPAKVAGVKRIIMVTPPGVNTTINPAILVAA
QEAGVDEIYRVGGAQAIAAMAYGTETIAPVNLITGPGNIYVTLAKKLVFGTVGIDSLAGP
SEVLVIADETAHPVHLAADLLAQAEHDPLAASILLTTNAALAQKVAREVLHQLEYHPRRE
PTEKSIAHFGLVGVVESLEVAAQLSNEFAPEHLELQIAAPWDLLDKIRHAGAIFLGKSTP
EAVGDYLAGPNHTLPTSGAARYASPLSVETFLKHSSLIEYSANALIKMAPAIMTLAEAEG
LPAHGDSVRLRLEQPEQNS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggggatcatgctgcgaatcctgaactgccttgaagatattcgctccgaattgcggcgc
atctgtgatcgtatccacgatgatcaggtgattcataaagaggcgaccgttcagcaaatt
ctccaaacggttcagcgacaaaaagacctcgccctcatccattacaccgccgaatttgat
cacgttgaattgactgtggattccttgcgggtcagtggtgccgaattggatgcagcctat
caacaggtctccaaagaactcctagatgccatccgccttgcccatcagcaaattaaagcc
ttccatgaacaacggattcccaaaaactggatccaatttcctgccgagggagtcgtttta
ggcaaacgttataccccagtagatgcggcgggtttatatatccccggtgggcgggcggcc
tatcccagtacggtattgatgaacgcaatcccggcaaaagtggcaggggtcaaacggatc
attatggtcactccccccggagtcaatacaacaatcaatccggcgattttagtggcggcc
caagaagcaggggtggatgaaatttatcgggttgggggagcccaggccattgcggcgatg
gcttacggaacagaaacaattgcccctgtgaatttaattaccgggcctgggaatatttat
gtgaccttagcaaaaaaactagtctttggcactgtggggattgactccttggctggcccc
tcagaagttttagtcattgcagacgaaaccgcccatcctgtccatctagccgcagatctg
ctggcccaggccgagcatgaccccttggctgcttcaatcttgctgaccaccaacgccgct
ttagcccaaaaagtcgctcgcgaagttctgcaccagttggaatatcacccccgccgggaa
ccaactgaaaaatccatcgcccattttggcctggtgggggttgtggaatccctagaagtg
gcggctcagttgtccaatgaatttgccccggagcacttagaactgcaaattgctgccccc
tgggacttgctggataaaatccgtcatgcgggagctatttttctagggaaatccaccccc
gaagcggtgggcgattacttagccggcccgaaccacactttacccacatccggcgcagcc
cgttacgcatcacctttaagtgtagaaacgtttttaaaacattcaagcttaattgaatat
tcagccaatgccttaattaaaatggccccagctatcatgacactagccgaggccgaagga
cttcctgcccatggagactctgtccgcttacgattggagcaacccgaacaaaattcctag

DBGET integrated database retrieval system