KEGG   Synechococcus sp. PCC 6312: Syn6312_1443Help
Entry
Syn6312_1443      CDS       T02370                                 

Definition
putative bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Syn6312_1443
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Syn6312_1443
Enzymes [BR:syne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Syn6312_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1418128..1420527)
Genome map
AA seq 799 aa AA seqDB search
MQVPPSIPPQAWQRSIGQGWEKPYTVRYASNLDDGPWHGMPLGGFGAGCIGRSSRGDFNL
WHLDGGEHIFQTMPGCQFSVFEQAGDHSQAYALCTEPPSDGTLGAWNWYPTAKGTYGALY
PRSWFQYQGVFQAGLTCEQFSPIIPDNYQETSYPVAVFVWAAHNPTDQPITLSIMLSWQN
LVGWFSNATPASEIRIRDDGSPVYDYTPRLGQSQGNYNSFHQSQTQASCLLQRQRDPHTA
IKEGEGEWAFSVPVRDDLEIFYHTRWNPVGDGGELWSSFSRDGSLSNLENNQPASDIEQI
GATLAVRFTLAPGESKEIPFGLAWDLPVTEFAPNVNYFRRYTDFWNRSGTNAETIAQVAL
ENYQKWSEQIGAWQQPILEHPDWPDDFKMALINELYDLTSGGSLWTAASELDPLGQYAVL
ECLDYRWYESLDVRLYGSFALLYLWPELEKGVMRAFARAIPTEDPKLRIIGYYYQGDPET
AHRAPRKIAHATPHDLGAPNEHPWQASNYTSYQDCNLWKDLASDFVLLVYRDYLLTGATD
LEFLTDCWPAIVSSLDYLKTFDTDGDGLPENSGAPDQTYDDWQLKGVSAYCGGLWIAALE
AALAIAQILEKQGNNTKLEQEKWQAWLSQSRPTYQAKLWNGQFYRLDSDSNSQVVMADQL
CGQYYARLLNLPDVVPIECAESALKTVYDVCFLKFHEGQFGAANGLLPDGSPEKPNATHP
LEVWIGINYGLAAFLYQMGLEDGAWRLTQTVIRQIYDNGLQFRTPEAITAVGTFRACMYL
RPMAIWAMYGQLKSLHKSH
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtccccccctctatccccccccaggcctggcaacgatccattggtcaaggttgg
gaaaagccctacaccgtccgttatgccagtaatttagacgatggcccttggcacggaatg
cccctaggtgggtttggagcgggttgtattgggcgatcttcacggggagattttaacctc
tggcatttggatggcggcgaacatattttccaaaccatgcccggctgtcagttttctgtg
tttgaacaagctggcgatcactcccaggcctatgccctttgtaccgaaccgccgtcagat
ggaaccctcggggcctggaattggtatccgaccgcaaaaggaacctatggcgcgctctat
ccccgcagttggtttcagtatcagggggtgttccaggccggtttaacctgtgagcagttt
tcgccgattattcccgataactatcaagagaccagttatcccgttgccgtgtttgtttgg
gcagcccataaccccacagatcagccgatcaccctcagcatcatgctcagttggcaaaat
ctggtcggttggtttagtaatgccacgccagcctcagaaattcgcatccgggatgatggc
agtccggtttatgactacacgccacgcttggggcaaagtcaggggaattacaacagtttt
catcaatcccaaacccaggccagttgtttactccaacgtcagcgggatccgcatacagcc
attaaagaaggcgagggcgaatgggcgttttcagtacccgtgagagatgatctcgaaatt
ttctaccatacccgttggaacccagttggcgatgggggggaactttggtcatcctttagt
cgggatggttcactcagtaatcttgaaaataatcaaccggcatcggatatcgaacaaatt
ggggcgacgttggcagtccggtttaccttggctcccggtgaatccaaagaaattcccttt
ggcctggcctgggatttgccggtgacggaatttgccccaaatgttaattactttcgccgt
tatacggatttctggaatcgctcgggaaccaatgctgaaacgattgctcaagttgcttta
gaaaactatcagaaatggagtgaacagatcggggcctggcaacaaccaattttagagcat
cccgattggcccgatgacttcaaaatggctctgattaatgagctttatgatttgaccagt
ggcggcagtttatggacagcagcatcggaacttgatcctttgggacaatatgcggttttg
gaatgtttggattatcgctggtatgaaagtttagatgttcgactctatggttcttttgct
ctactttacttgtggccagaattggaaaaaggggtgatgcgggcctttgccagagcgatt
cccacggaagaccccaaactccggatcattggctactactaccaaggcgatcccgaaaca
gcccatagagcaccccggaaaattgcccatgccacgccccacgatctcggcgcacccaac
gaacatccctggcaagcgagcaattacaccagttatcaagactgcaacctttggaaagat
ttagcctcggattttgtcttgttggtctatcgggattacctattaacgggcgcaacggat
cttgagtttttaaccgattgctggcccgcgattgtcagtagtttggattacttgaaaacc
tttgatacggatggggatggcttaccggaaaacagtggcgcaccggatcaaacctatgat
gattggcaactcaaaggagtcagtgcctattgtgggggcctgtggattgcagccttagaa
gcagctttggccattgcccagattttagagaaacagggaaataatacaaaactcgaacaa
gagaaatggcaggcctggctcagtcaatcccgccccacttatcaagcgaaactctggaac
ggtcagttttatcgtctggatagtgatagtaactcccaagtagtgatggcggatcaactc
tgtggccaatactatgccaggttactcaatttaccggatgttgtcccgattgaatgtgct
gagtcggccttaaaaaccgtttatgatgtctgttttttgaagttccatgagggtcaattt
ggggcggccaatggcctgttacccgatggttccccggaaaaacccaatgccactcacccg
ctcgaagtttggattggaattaactatggcctggctgctttcttgtatcaaatgggttta
gaagacggggcctggcggttaacgcaaaccgtgattcggcaaatttatgacaatggcctg
caatttcggactccggaagcgattacggctgtgggaacctttcgggcctgtatgtatctg
cgaccgatggcgatttgggcgatgtatggacaacttaagagtttacataaatcacattaa

DBGET integrated database retrieval system