KEGG   Synechococcus sp. PCC 6312: Syn6312_1460Help
Entry
Syn6312_1460      CDS       T02370                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syne00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syn6312_1460
Enzymes [BR:syne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Syn6312_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1437196..1437822
Genome map
AA seq 208 aa AA seqDB search
MIGFLRGTILGTQKLGVNRIILCLDVQGVGYDLLITTRVLNALPPVAEPVALFTHLQVRD
DQLLLYGFGSAPERDLFRQLISVSGVGPQLGLALLDSLGLSELIQAIVSGNTRLLSRTPG
VGTKTAERLALELKTKLAAWRDQTGLVTTPAAGPMAAIQEDVEMTLLALGYTAQEIRQAL
DAVGQSTALAKNADAEAWLRETITWLSQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattggttttttgcgcgggacaattcttggtacccaaaaactcggagtcaaccgaatt
attctctgcttggacgttcaaggcgtaggctatgacctcttaatcacaactcgtgtcctc
aacgcactcccgcccgtagctgaacccgtggccctgtttacccatctgcaagtgcgcgat
gatcaactcctgctgtatgggtttggttccgcgccagaacgggatttatttcggcagttg
attagtgtcagtggggttggtccccagttaggactcgccctcttagacagcttgggatta
tcagagttgatccaggccattgtcagcggcaatacgcgcctcctgagtcggactcctggg
gtcgggacaaaaacggcggaacgcttggccttggaactaaaaacgaaacttgcggcctgg
cgagatcaaaccggcctggtgactactcccgctgccgggccaatggcggccattcaagaa
gatgtggaaatgaccctcttggctttggggtatacggcccaggaaatccgccaggccttg
gacgcagttggacaatcaacggccttagccaaaaatgccgatgccgaagcctggttacgg
gaaacaattacgtggttgagtcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system