KEGG   Synechococcus sp. PCC 6312: Syn6312_1462Help
Entry
Syn6312_1462      CDS       T02370                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syne00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1440033..1442039
Genome map
AA seq 668 aa AA seqDB search
MVAALPIAPTFPLTAVVGQEAIKLALLLAAVDPGLGGVVIAGRRGTAKSVMARAIHALLP
PIEIVKGSLSNCDPANPGAWDKRLIEQIQAGEIESPPPTEVIPAPFIQIPLGITEDRLIG
AVDVSQSVQKGEAIFQPGLLASAHRGVLYVDEINLLEEQIANLLLTVLTEGRNQIEREGI
SFQHPCQPLLLATYNPEEGPLRPHLLDRIAIALSADAVLGLDERVQAVDQATEFANSPQA
FMAQYGTELEDLQTQIILAREWLKDVKIHRQQIAYLVTEAIRGGVEGHRAELFAVRVAKA
HAALNGRSEVTAEDLRRAVELVIVPRATLIDIPPEQLAPPPPQPNQAEDQEEPDQEDEDE
PEDNEEQQAEPPSIPEEFVFEAEGVILDESVLYFAQSAQRQGKSGSRSLVYSQDRGRYVR
PMIPKGRGGRIAVDATLRTAAPYQKSRRAKQPQRRVIVESGDVRIKRLARKSGALIIFVV
DASGSMALNRMNAAKGAVLRLLTQAYQNRDMISLIPFRGDQADVLLPPTRSIEAARRRLD
TLPCGGGSPLAHGLTQAVRVGLNAQQSGDVGQVMIVAITDGRGNIPLAKSLGEPIPEGEK
PDIKAELLDIAGKIRGLGLKLLVVDTENKFISTGFGKELAAQAGGKYYHLPKATDQAIAA
VTQNALNF
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggttgctgctttacccattgctccgacttttcccctgacggccgttgttggacaggag
gcgattaaacttgcactgttattagcggcagttgatccaggcctggggggtgtcgtcatt
gccgggcggcggggcacagctaaatccgtcatggcccgggcgattcatgccttgttacct
ccgattgaaatcgtcaaaggctccctgagtaattgtgatccagctaaccctggggcctgg
gataaacggttaattgagcaaattcaagcgggtgaaatcgagtctcctcccccaaccgag
gtcattccggctccatttattcaaattcctttgggaattacggaagatcggctgattggg
gccgtagatgtcagtcaatcggtgcagaaaggagaagccatttttcaacccggcctgtta
gcctctgcccaccgcggagttctttatgtggacgaaattaacctcctagaggagcagatt
gccaatctcttgctgacggtcttaacggaaggacgcaaccaaattgaacgagaagggatt
agttttcagcacccctgccagcctttgttattagcaacctacaacccggaagaaggccca
ctacgaccccatttactggatcgaattgccattgctctgagtgctgatgcggtgttgggg
ttagatgagcgagtccaggccgtcgatcaagccacggaatttgccaattcgccccaggcc
ttcatggcccaatatggcaccgagttggaagacctgcaaactcagattattttggcgcgg
gaatggctcaaggatgtcaaaattcaccgccagcaaattgcctatctcgtcactgaagca
atccgggggggagttgaggggcatcgggctgagttgtttgcagtccgggtggccaaagct
catgcggccctgaatggtcgttccgaagtcaccgccgaagatttgcgccgggccgtggaa
ttggtgattgtgccgcgggccaccctcattgatattcccccagagcaactcgccccgccg
ccgccccaaccaaaccaggccgaggatcaggaggaacccgaccaagaagatgaagacgaa
ccggaagacaacgaagagcaacaggccgaaccccccagtatcccagaagagtttgtcttt
gaagcagaaggggtaattttggatgagtcggtcttgtattttgcccaatcggcccaacgt
caagggaagtcgggaagtcggagtttagtctattcccaggatcgggggcggtatgtacgg
ccgatgattcctaagggacggggcgggcgtattgcggtggatgcaaccttgaggacggcg
gctccctatcaaaaatcccgacgggccaagcaaccccaacggcgagtcattgtcgaatcc
ggggatgtgcgaattaaacggttggcgcgcaaatctggggcgttgattatctttgttgtg
gatgcatcgggttccatggccttaaatcggatgaatgcagccaagggagcggttttacgc
ttactcacccaggcctaccaaaatcgggacatgatttccttgattcccttccgcggtgac
caggccgatgtcttgttacccccaacgcgctcgatcgaagcggctcgccggagattagat
accttgccctgtgggggtggctctcctttggctcatggtttaacccaggccgtccgagtt
ggactcaatgctcagcaatccggggacgtgggacaggtgatgatcgtggcgattaccgat
ggccggggcaatattcccttagcaaaatctttgggtgaacccattccagaaggggaaaaa
cctgatatcaaagccgagttactggacattgccggtaaaatccggggcctggggctaaag
ctgttggtggtggatacggaaaataaatttatctcgacggggtttggtaaagaactagca
gcccaggccgggggaaaatattatcatctgcccaaagcgaccgaccaggccattgccgct
gtcacccaaaacgcccttaacttctaa

DBGET integrated database retrieval system