KEGG   Synechococcus sp. PCC 6312: Syn6312_1508Help
Entry
Syn6312_1508      CDS       T02370                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syne00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1486209..1486913)
Genome map
AA seq 234 aa AA seqDB search
MTISTNTLNLPDPPANGKRLTTAPILPDRNTHQGKEPLIQAPPADVAKDEMMAAVKTMLL
SVGEDPDREGLLKTPKRVAEAMQFLTSGYSQSLEALVNGAVFDEGHDEMVLVRDISAFSL
CEHHMLPFIGKVHVAYIPNQRVIGLSKLARIVEMYARRLQVQERLTRQIAEAVNEVLDPQ
GVAVVMEASHMCMVMRGVQKPGSWTVTSSMLGVFREDQKTREEFLNLVRHQQNF
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttctaccaacacgcttaatttgcccgatcctcctgccaacggaaaacgcctc
accactgccccgatcttgccggatcgcaatacccatcaaggcaaagaacccctgattcaa
gccccacccgctgatgtagccaaagatgaaatgatggctgctgtcaaaaccatgctcctg
agtgttggggaagatccggatcgagaagggctattgaaaaccccgaaacgggtggctgag
gcgatgcagtttctcaccagtggttattcccagtccctagaagcattggtcaatggggca
gtctttgatgaaggccatgatgagatggtgttggtgcgtgatatcagcgcctttagcctc
tgtgaacaccatatgctcccctttatcggcaaagttcatgtggcctatattcccaatcaa
cgggtcattggcctgagcaaattggctcggattgtcgagatgtatgcccgccgcctccag
gtgcaagaacgcctaactcgccaaattgccgaagccgtgaatgaagtcctcgacccgcaa
ggtgtggccgtggtcatggaagcctcccatatgtgtatggtgatgcgaggagttcagaaa
cctggctcttggacggtaacaagttccatgttaggcgtattccgggaagatcaaaaaacg
cgggaagaatttctcaacctggtgcggcatcaacaaaacttttaa

DBGET integrated database retrieval system