KEGG   Synechococcus sp. PCC 6312: Syn6312_1743Help
Entry
Syn6312_1743      CDS       T02370                                 

Definition
fatty-acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:syne01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:syne01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1736623..1737447
Genome map
AA seq 274 aa AA seqDB search
MTLATYVKPPISWPVVGFMVLLHLSLLLVFIPGMFSWTGVGLALILHWVTAGLGITLGWH
RLLTHRSFQVPKWLEYVLVFLGTLSMQGGPIWWVGLHRHHHLYSDQAVDHHDSCKGFWWS
HFEWMLRDVPAEAEIPKFTKDIADDPFYRFLDENFVMIQVAFAILLYFVGGWQFVVWGVL
VRLVTVYHTTWLVNSATHKFGYRTFDSADRSTNCWWVALLTFGEGWHNNHHAYQYSARHG
LRWWEIDLTWMTIQVLEFLGLAKKVRLVEVPMTE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgccacttacgttaaaccaccgatttcctggcctgttgtcggatttatggtt
ttgttacatctttctcttttgttagtctttatcccagggatgtttagttggacaggggtg
gggttagccttaatcctccactgggtgacagccggcctgggaattaccctgggatggcat
cgcctgctcacgcaccggagtttccaagttcccaaatggctggagtatgttttggtcttc
ttaggaaccttatcaatgcagggcgggccgatttggtgggttggcttacatcggcatcat
cacctctactctgatcaagcggtggatcaccatgattcttgcaagggcttctggtggagt
cattttgagtggatgttacgagatgtgcccgctgaagcagaaattcctaagtttaccaaa
gacattgccgatgacccgttttatcgcttcttagatgaaaattttgtgatgattcaggtg
gcctttgcgattctcctgtactttgttggcggttggcagtttgtcgtttggggggtctta
gtgcgcctcgtgacggtgtatcacaccacttggttggtcaatagtgccacccataagttt
ggctatcggacgtttgacagtgctgaccgttcaaccaattgctggtgggtggccctttta
acctttggtgaaggctggcacaataatcaccatgcttatcagtattcggctcgtcatggt
ctgcgctggtgggaaattgatttaacctggatgaccattcaggttttggagttcctaggg
ttggctaaaaaggttcgtttagttgaagttcctatgacagagtag

DBGET integrated database retrieval system