KEGG   Synechococcus sp. PCC 6312: Syn6312_1827Help
Entry
Syn6312_1827      CDS       T02370                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Syn6312_1827
Enzymes [BR:syne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Syn6312_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1814659..1816284)
Genome map
AA seq 541 aa AA seqDB search
MPFPRAAGLLLHPTSLPGGQGIGDLGQAALDFVDFMADTGQQLWQMLPLGPTGYGNSPYM
CYSAMAGNPVLISLDKLVQGGWLEAAAVSALQFPAHDWVDYDGVIPAKLALLQKAAQVFK
EKATPEDHAKFRQFCQAMAFWLPTYALYMALKDEQENQPWYEWEPGLAWRNPEAITAAEA
RLAPQVFSYQFQQFIFFQQWSRLRAYANQKGIKMIGDIPIYVAHDSADVWAFPHLFELVP
QSPQAVPTVTGDTESPEKLSPKPGLVAQMAGVPPDYFSETGQLWGNPIYNWQAMEQEGYR
WWIERFRVLFDCMDLIRVDHFRGFEAYWQVPQGEETAIKGEWVKGPGAKLFEVVQAELGE
LPILAEDLGEITPEVIELRDQFAFPGMKILQFAFGGGADNPFLPFNYERNFLVYTGTHDN
NTTVGWFAELGEWEQNRIRDYLGAMTHEGIHWDLIRLAFSSVANQAIIPVQDLLGLGTPA
RMNFPSKPEGNWAWRLRPEEFQDLQGGLGQRLKYLTQLYGRYPSPPPETGATATESDNNG
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccttttccccgtgcggctggtttactccttcatccgacatccttacccggtggtcag
ggcattggcgacttagggcaagcagctttggattttgttgatttcatggccgacactgga
caacaactctggcaaatgcttccccttggccccaccggctacggcaactctccctatatg
tgttattcggcgatggcggggaatccggtgctgattagcctggataaactggttcaaggg
ggatggttagaggccgctgcggtgtctgctctccagtttccggcccatgattgggtggac
tacgatggggtgattcctgccaaacttgccctcttgcaaaaagcggcccaggtctttaaa
gaaaaagctacccctgaggatcacgctaagtttaggcaattttgccaggccatggcgttt
tggctcccgacctatgccctctacatggccctcaaagatgagcaagaaaatcagccttgg
tatgaatgggaacctggcctggcctggcgaaacccagaagccattaccgccgctgaagcc
cgcctggccccacaggtgtttagttatcaatttcagcagtttatcttctttcagcaatgg
tcaaggttgcgggcctatgccaaccagaaggggatcaaaatgattggggatattcccatt
tatgtcgcccatgatagtgcggatgtttgggcctttccccatctgtttgagttagtgccc
caatccccccaagcagtaccaaccgtgaccggagatacagaatccccagaaaaattaagc
cccaaacccggcctggtggcccaaatggctggtgttcccccggattatttcagcgaaacg
ggccaactctggggcaacccgatctacaactggcaggccatggaacaagagggctatcgg
tggtggatcgagcggttccgcgtgctttttgactgtatggatttaatccgcgtcgatcac
ttccgaggctttgaggcctattggcaagttccccagggggaagaaacggcgatcaagggg
gagtgggttaaaggcccaggggcgaagttgtttgaagttgtccaggccgagttaggggag
ctacccattttggcggaggatttaggggaaatcactccagaagtcattgaattgcgggat
cagtttgcatttccgggtatgaagattctccaatttgcctttgggggcggtgctgacaac
ccttttttgccgtttaactatgagcgtaatttcttggtctataccggaacacacgataac
aacaccactgtgggctggtttgcggaactgggagaatgggagcaaaatcggattcgggat
tatttgggcgccatgacccatgaggggattcactgggatttgattcgtttggcctttagt
tccgttgccaatcaagcgatcattcccgtccaagatttattaggattagggacacccgcc
cggatgaattttcccagcaaaccagagggcaattgggcttggcggttgagaccggaggaa
tttcaggacttacaggggggtctgggacaacgcctcaaatacctcacgcaactctatggc
cgctacccctcaccaccgccggaaactggagccactgcaactgagtctgacaataatggg
atttga

DBGET integrated database retrieval system