KEGG   Synechococcus sp. PCC 6312: Syn6312_2351Help
Entry
Syn6312_2351      CDS       T02370                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syn6312_2351
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syn6312_2351
   00020 Citrate cycle (TCA cycle)
    Syn6312_2351
   00620 Pyruvate metabolism
    Syn6312_2351
Enzymes [BR:syne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syn6312_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2308202..2309494
Genome map
AA seq 430 aa AA seqDB search
MIREVFMPALSSTMTEGKIVAWVKEPGDKVEKGETVVIVESDKADMDVESFYEGFLAVIT
VPAGSSAPVGATIGLVAETEAEIAQAQAQAPSSPATSPPTPSSNGNSQSSNGSSVAPPII
TISTPVASGRLVASPRAKKLAKDLKVDLKTLEGKGSGPHGRITMADVEAAVGKVVTPTIP
QVPQAPVTLPTPANITPTPTVSPAALAGEVQPLTTLQNAVVRNMNASLQIPDFHVSYTIT
TDGLDALYKQIKSKGVTMTALLAKAVALTLQKHPIINACYTEQGIQYKPNINIAIAVAMP
GGGLITPVLKDADKVDIYTLSRTWKDLVERARAKQLQPDEYNSGTFSLSNLGMFGVNGFD
AILTPGQGAIMAVGGSKPTVVATKEGLIGVQSQMEVNITCDHRVIYGADAAAFLQDLAKL
IATNPQALTL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgaagtgtttatgccggccctaagttcaaccatgactgaagggaaaattgtt
gcttgggtcaaagagcctggggataaggtggaaaagggcgaaacagttgtcattgttgag
tcagataaggccgatatggatgtggaatccttctatgaggggttcttagccgtcattacg
gttcccgccggatcttccgcccctgtgggtgccaccattggcctagttgcggaaaccgaa
gccgaaattgcccaagcccaggcccaagcccccagttcacccgccacctcgcccccaacc
ccaagcagtaatggaaatagtcaaagcagcaatggtagttcagtcgctcccccgatcatc
acgatttcaactcccgtggccagtggtcgtttagtggcctcgccccgggctaaaaagcta
gctaaagacctgaaggttgacctaaaaaccctcgaaggcaaagggagcggcccccatggt
cggattacgatggctgatgtggaagctgcggtagggaaagttgtcacaccgaccatccct
caagtcccccaggccccggttactctccccactcctgcaaatattactccaaccccaacc
gtcagccccgctgccttagccggagaagttcaacccctgacgactctccaaaatgcggtt
gtgcggaatatgaacgccagcttgcaaattcctgacttccacgttagctacaccatcacc
accgatggcctggatgccctctacaagcagatcaagtccaaaggtgtgacgatgacggct
ctcttggccaaggcagttgcgctcactctccaaaaacacccaattatcaacgcctgctac
acagaacaaggcatccaatacaagcccaacatcaatattgccattgcagtggccatgccc
ggcggtggtttgattacccctgtgttgaaagatgcggacaaagtagatatttatactctc
tctcggacttggaaggatttagtcgagcgggcccgggccaagcaactgcaaccagatgaa
tataacagcggcacctttagcctctctaatttgggtatgttcggtgtaaacgggtttgat
gcaattctcacccccggtcaaggggcaattatggcggtgggcggctcaaaacccacggtc
gtggccacaaaagaggggttaattggagtgcaatcccagatggaagtgaatattacctgt
gatcatcgagtcatctatggggctgatgccgctgcttttctccaagacctggccaaactc
attgccaccaatccccaggccttgacgttatag

DBGET integrated database retrieval system