KEGG   Synechococcus sp. PCC 6312: Syn6312_2928Help
Entry
Syn6312_2928      CDS       T02370                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Syn6312_2928
Enzymes [BR:syne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Syn6312_2928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2873496..2874680)
Genome map
AA seq 394 aa AA seqDB search
MTSSSSESPLFNRPTEAQQALEKERHLPLTGWQQEVSQGLAFGLEAADSIKDRTISTFSR
GELPHFAGINTFLKAPYLEDVRQVGNYDVAIVGVPHDSGTTYRPGTRFGPQGIRRISALY
TPYNFEFGVDLREQITLCDVGDIFTIPANNEKSFDQISKGIAHIFASGAFPIILGGDHSI
GFPTVRGVCRHLGDKKLGIIHFDRHVDTQETDLDERMHTCPWFHATNMANAPAKNLVQLG
IGGWQVPRQGVKVCRERATNILTVTDITEMGLDAAADFALERALDGTDCVWISFDIDCID
AGFVPGTGWPEPGGLLPREALYLLGKIIRNAPVCGMEVVEVSPPYDISDMTSLIATRVIC
DAMAHLVISGQLPRTTKPDYIHPEANMGVDQPWV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttcgagtagcgaatctcccctgtttaatcgcccaaccgaggctcaacaggcc
ctagaaaaagaacgacatttacccctgaccggttggcagcaggaagtatcccaggggtta
gcgtttggcctggaagccgcagacagtattaaagaccgcaccatttccacgttttctcgg
ggggaattaccccatttcgctggcatcaatacctttctcaaagccccctacctagaagat
gtccggcaagtggggaattacgatgtggcgattgtcggtgtcccgcacgattctggcacc
acctatcggccaggaacacggtttggcccccaagggattcgccggatttcggccctttat
acgccctacaactttgaatttggggttgacctgcgggagcaaattaccctctgtgatgtc
ggcgatatttttacaattccggccaataatgaaaaatcctttgaccaaatttctaaaggc
attgcccatatttttgcctctggggcgtttccgatcattttgggcggcgatcactcgatt
ggctttcccacggtgcgcggagtctgtcggcatttaggtgataaaaagcttggcatcatt
cactttgaccgccatgtggacacccaagaaaccgacttagatgaacggatgcacacctgt
ccttggttccatgccaccaatatggccaatgctccggccaaaaatctggtgcagttggga
attggggggtggcaagtgccgcggcaaggcgtaaaagtctgtcgagagcgagcaacgaat
atcctgacggtgactgatattaccgaaatgggcctggatgccgccgccgattttgccttg
gaacgggctttagatggcacggattgcgtctggattagctttgatattgattgcattgat
gcgggttttgtccctgggacgggctggccggagccaggtgggttgttgcccagagaagcc
ctgtatttgctgggtaaaattattcgcaatgcgccagtttgtggaatggaagtggtggaa
gtttcccccccctatgacattagtgatatgacctccttgatagcgacgcgggtgatttgt
gatgccatggcccatttggtgatttctggtcagttaccccggactaccaaacccgactac
attcatccagaagctaatatgggcgtggatcagccttgggtttag

DBGET integrated database retrieval system