KEGG   Synechococcus sp. PCC 6312: Syn6312_2960Help
Entry
Syn6312_2960      CDS       T02370                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Syn6312_2960
Enzymes [BR:syne01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Syn6312_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2898110..2902093
Genome map
AA seq 1327 aa AA seqDB search
MFTHVKSTIRHLAPEALNGRSLMRVVYVVLEAQYQSALSGAVKTINAKNPGLAIEISGYL
LEELRNPENYAAFCEDVARANVFIASLIFIEDLADKVVAAVEPYRDRLDVAVVFPSMPQV
MRLNKMGSFSMAQLGQSKSMIGQFMKKRKEKAGSSFQDGMLKLLQTLPKVLKYLPIDKAQ
DARNFMLSFQYWLGGSPENLENFLLMLGDRYVFKGELNIAEQTYQDPVTYPDTGIWHPLA
PQMFGDLKEYCNWFNSRRDISADLKDPLVPTVGLILQRTHLVTGDDAHYVAVVQELESSG
ARVIPVFSGGLDFSKPMDLFFYDPLQPEKAIVDCVVNLTGFALVGGPAKQDHPKAIAALK
KLNRPYMVSLPLVFQTTEEWEDSDLGLHPIQVALQIALPELDGAIEPIILSGRDGATGKA
IALQDRVETIAQRAMNWANLRRKPKVNKKVAITIFSFPPDKGNIGTAAYLDVFGSIYKVM
EGLKNNGYDVENMPANAETLMQEILHDAQARYSSPELNIAYRMPVNEYEKLTPFAKRLEE
NWGKAPGELNSDGQNLLVFGKEYGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAAYYT
YLNKIWKADAVLHFGTHGSLEFMPGKQMGMSGDCYPDNLIGNIPNLYYYAANNPSEATIA
KRRSYANTISYLTPPAENAGLYKGLRELSELIASYQTLKESGRGIQIVNTIMDKCRLVNL
DQDVALPDQDAADLSAEDRDGIVGKIYIKLMEIEARLLPCGLHVIGKPPSTEEAAATLVN
IASLDRPEDEILSLPRIIAQSLGRDMEEIYKNSDAGVLADVELLQAITQATRAAVDALVQ
AQADADGRISKVSKLNFFNMGRKEPWIEALHNAGYTQVSAADLKPLMEYLEFCLQQVVAD
NELGALLQALEGEYILPGPGGDPIRNPDVLPTGKNIHALDPQSIPTAAAVQSAKVVVDRL
LARQKAENNNQWPETIALVLWGTDNIKTYGESLAQVLWMVGVRPLPDSLGRMNKLELISL
EELGRPRIDVVVNCSGVFRDLFINQMDLIDRAVKMAAEADEPAEMNFIRKHALKQAEELG
VNIRQAATRVFTNASGSYAANVNLAVENSSWEQESELQDMYLSRKSFAFSADSPGTMEQS
RQIFESALKTVDATFQNLDSAEISLTDVSHYFDSDPTKVVSSLRKDGKQPLSYIADTTTA
NAQVRSLSETVRLDSRTKLLNPKWYEGMLSHGYEGVREISKRLVNTMGWSATAGAVDNWV
YEDVNTTFIHDEEMRQRMLNLNPHSFRKIVSTLLEVNGRGYWETSEENLDLLRQLYQEVE
DKIEGVE
NT seq 3984 nt NT seq  +upstreamnt  +downstreamnt
atgttcacccacgtcaagtccacaattcgccatttggccccagaagcactaaacgggcgg
tctttgatgcgagtggtctatgtggtgttagaagcccagtaccaaagtgctttgtctgga
gcggtaaagacgattaatgcaaaaaaccccggcctggccattgaaatcagtggttatctc
ctggaagaactgcgcaacccagaaaactacgctgccttttgtgaagatgtggcccgggcc
aatgtttttattgcctcgttgatttttattgaagatctggccgataaagttgtcgcagcg
gtggaaccctatcgggatcggttagatgtggccgtggtctttccctccatgccccaggtg
atgcgcctcaataaaatgggcagtttttccatggcccaactcggtcagtccaagagcatg
attggccaattcatgaaaaaacggaaagagaaggctggctctagtttccaagatgggatg
ctcaagctcctgcaaaccctgccgaaagtcctcaaatatctccccattgacaaagcccaa
gatgcccgcaactttatgctcagtttccaatattggctgggtggctccccggaaaacctg
gaaaactttttgttaatgctaggggatcggtatgtcttcaaaggcgaactcaacattgcc
gagcaaacctaccaggatcctgtcacctatcccgatacgggcatttggcaccctctcgcc
ccgcaaatgttcggggacttaaaagaatattgcaactggttcaacagccgtcgcgacatt
tctgctgatctcaaggatcccttagtcccgactgttggtttgattctccagcgtacccat
ttggtcacgggggatgatgcccattatgtggcggttgtccaggaattagaatcctctgga
gcacgagtaattccagtgttttcggggggtctggatttctcgaaaccgatggatctgttt
ttctatgatcccttgcagccagaaaaagcgattgtggattgcgttgtgaatctaactgga
tttgccctagtcggtggcccggctaaacaggatcatcccaaagccattgccgcgctgaaa
aagctcaaccgtccctatatggtttccttgcccctcgtctttcaaaccaccgaagaatgg
gaagacagtgatttgggcctgcatccgatccaagttgcgctccagattgccttgccagag
ttagacggagcgattgaaccaattattctctcagggcgggatggagccaccggaaaagcg
attgctctccaagatcgggtcgaaaccattgcccaacgagcgatgaattgggccaacctc
cgccgcaaaccgaaagttaataaaaaagttgcgatcacgattttcagtttcccaccggat
aaaggcaacattggtaccgccgcctatttggatgtctttggctccatctataaagtcatg
gagggtctgaaaaacaacggctacgatgtcgaaaatatgccggccaatgccgaaaccctg
atgcaggaaattctccacgatgcccaggcccggtacagtagccccgaactcaacatcgcc
tatcggatgccggtgaacgagtacgaaaaactcaccccctttgccaaacgtctggaagaa
aactggggtaaagcaccgggagaacttaacagtgatgggcaaaatctcctcgtctttggt
aaagaatacggcaacgtctttattggggtgcagcccacgtttggctatgaaggcgatcca
atgcggttgctcttttcccgctcggccagtccccaccacgggtttgccgcctattacact
tacctgaataaaatctggaaagccgatgcagtcttacactttggcacccacggctccttg
gaatttatgcccggtaaacaaatggggatgtccggcgattgctatcccgacaacctgatt
ggcaacattcccaacctttactactacgccgccaataacccctcggaagcgaccattgcc
aaacgccgcagttacgccaacaccatcagttacctcaccccaccggcggaaaatgctgga
ctctataagggcctgcgggaactgagtgagttgattgcctcctaccaaaccctaaaagaa
agcgggcggggcatccagattgttaacacgattatggacaaatgccgcctggtcaatttg
gatcaggatgtggccttaccggatcaggatgcggcggatctctcggcggaagaccgggat
gggattgtcggcaaaatctacatcaaattgatggaaattgaggctcgcttattgccctgt
ggcctgcatgtgattggtaagccccccagcaccgaagaagccgccgccaccttggtgaat
attgccagcttggatcgcccggaagatgagattctcagcttgccccggattattgcccaa
agtctgggccgggacatggaggaaatttacaaaaacagtgatgccggagttttggccgat
gtggagctcttgcaagcgattacccaggccacccgtgctgctgttgatgctctcgtccag
gcccaggccgatgccgatggtcggatttccaaggtgtctaagctcaatttctttaatatg
ggccggaaagaaccttggattgaagccctccataatgcgggttacacccaagtcagtgcg
gccgatctcaagcccttgatggaatatctcgagttctgtttgcagcaggtggttgccgat
aacgagttgggggccttgcttcaagctttggaaggggaatatatcttgccggggcctggg
ggcgatccgattcgcaatcccgatgtcttgcccacggggaaaaatatccatgccttggat
ccccaatccatcccaacagccgccgccgtccaatcagccaaagttgtcgtggatcggtta
ctggcccggcaaaaagcagaaaacaataatcaatggccggaaaccattgccctggtgctc
tggggaacggacaacatcaaaacctatggggagtctttggctcaagtcctctggatggtg
ggggtgcggccgttgccggattccttgggacggatgaataaattggagttgatctccctc
gaggaactgggccgcccccggattgatgtggtggtcaactgttccggtgtcttccgggat
ttgtttatcaatcagatggacttgatcgaccgggcggtaaaaatggccgctgaagccgat
gaaccggctgagatgaactttatccgtaaacacgccctgaaacaggccgaggaattgggg
gtgaatattcgccaggccgcgacacgggtgtttactaatgcttccggttcctatgccgct
aacgttaacttggccgtggaaaacagcagttgggagcaagagtcggaattgcaggatatg
tatttatcccggaagtcctttgcgttctcggcagattcccctggcacgatggagcaatct
cggcaaatttttgagtcggcgctaaaaaccgtagatgccacgttccaaaacctggattca
gcggaaattagcttgacggatgtgagccactattttgattcggatccgacgaaagttgtg
agcagtctccgtaaggatggcaagcaacccctttcttatattgctgatacgaccacggcc
aatgctcaggttcggtcactttcggaaacggtgcgtttagatagccggacgaaactcctc
aatcccaagtggtatgaaggaatgctctcccacggttatgaaggggtgcgggaaatctcg
aaacgcttggtgaatacgatgggctggtcggccacggcgggcgcggtggataactgggtc
tatgaagatgtcaacacgacctttattcacgatgaggaaatgcggcaacggatgctgaat
ctgaatcctcattcgttccgcaaaattgtcagcacgttgttggaagtcaatggccggggt
tattgggaaaccagcgaggaaaacctagacttgttacgacagttgtatcaagaggtggag
gataaaattgaaggggtagaataa

DBGET integrated database retrieval system