KEGG   Synechococcus sp. PCC 6312: Syn6312_3318Help
Entry
Syn6312_3318      CDS       T02370                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syn6312_3318
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syn6312_3318
   00052 Galactose metabolism
    Syn6312_3318
   00500 Starch and sucrose metabolism
    Syn6312_3318
   00520 Amino sugar and nucleotide sugar metabolism
    Syn6312_3318
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Syn6312_3318
   00524 Butirosin and neomycin biosynthesis
    Syn6312_3318
Enzymes [BR:syne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Syn6312_3318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3242504..3243400)
Genome map
AA seq 298 aa AA seqDB search
MSGKEVLGIDLGGTAIKFGRFNPEGICLEKLTVPTPRPASPTAVIQTIVETLEKLDPDNK
TLGIGMGVPGPTDRAGRIVRVAINLDNWQNVPMAETLEKLTHRPVILANDANCALVGEAW
LGAGRTFKDVILLTLGTGVGGGILLDGKLFIGRHGTAAELGLITVDLHGHPCNSGNQGSL
EQHASATAIKRRTGMDAAALAAQARAGDGDALAFWATFGQDLAAGLATFLYVLTPEAVLI
GGGVSAAMDLFLPSLWAEVERRVLPSSREGLKIIRAELGNQAGIVGAAKLAWDLIEAS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaaagaggtactggggattgatctcggtggtacagcaattaaatttggccgg
tttaacccggagggaatttgcttagaaaagctcactgtgccaaccccacgcccggcctca
cccacagcagtcattcaaaccattgtcgaaaccctcgaaaagctggatccagacaacaaa
accttaggcattggcatgggagtccctgggcccacagatcgggctggcagaatcgtgcga
gtggcgattaatctcgataactggcagaacgtccccatggccgaaaccctggaaaaactc
acccatcgccccgtcattttagctaatgatgccaattgtgccttagtcggcgaggcctgg
ttgggagcgggtcggacattcaaagatgtcattctcttgaccttgggcacaggggtgggg
ggcggtattttgttagatggaaagctctttatcggtcgccatggtacagctgccgaactg
gggttaattaccgttgatttgcatggccatccctgtaacagcggcaatcaaggctctctg
gaacaacatgcttctgccacggccatcaaaagacgtaccgggatggatgcagcagcctta
gcggcccaggcccgggcgggagatggggatgccttagccttctgggccacctttggtcaa
gatttagccgctggcctggccacctttttgtatgtcttaactccagaggcagttttgatt
ggcgggggggtgagtgcggcgatggacttattcttaccgtctctctgggcggaagtggag
cggcgggtgcttccgagttcgcgagagggcttaaaaattattcgggccgagttaggtaat
caagccgggattgttggcgcggcaaagctggcctgggatttaattgaagcatcttaa

DBGET integrated database retrieval system