KEGG   Synechococcus sp. PCC 6312: Syn6312_3321Help
Entry
Syn6312_3321      CDS       T02370                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syne00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syn6312_3321
DNA repair and recombination proteins [BR:syne03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Syn6312_3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3245432..3246034)
Genome map
AA seq 200 aa AA seqDB search
MSTVYTRPLARLIEQLQRLPGIGPKSAQRLALHLLKRPESEIQALAQALLDAKQQVGVCG
VCFHLSAEPVCDICRTPTREDSLICVVADSRDVIAIEKTREYRGKYHVLGGLISPMDGIG
PEQLQIHPLIQRASQARVIEVILAINPSIEGETTTLYLGQLLKPFVKVTRIAFGLPVGGD
LEYADEMTLAKALEGRRELE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtacggtttatacgcgtccgttggctcgcttaatcgaacaactgcaacgactccct
ggcattggccccaagtctgctcagcgactagccttacatttactgaaacgtcccgaaagt
gaaatccaggcccttgcccaagctctcctcgatgccaaacaacaagtaggggtctgcggg
gtctgttttcatctatcggccgaaccggtttgcgacatttgtcggactccaacccgtgag
gatagcctcatttgcgtggttgccgactctcgcgatgtgattgccattgagaaaacccgt
gaatatcggggcaaatatcacgttttaggcggattgatttcaccaatggatggcattggc
cctgaacaattacaaattcatcccttgatccaacgggccagccaagcacgggtcatcgag
gttattttagctattaatcccagtattgaaggggaaactacaaccctctacttgggccaa
ctcctcaagccctttgtcaaagtgacccggattgcctttggtttacccgtgggtggggat
ttagaatatgccgatgagatgaccttagcaaaagctctggaaggacggcgagaattggag
tga

DBGET integrated database retrieval system