KEGG   Synechococcus sp. PCC 6312: Syn6312_3525Help
Entry
Syn6312_3525      CDS       T02370                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
syne  Synechococcus sp. PCC 6312
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:syne00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Syn6312_3525
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Syn6312_3525
Enzymes [BR:syne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Syn6312_3525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3450638..3452131
Genome map
AA seq 497 aa AA seqDB search
MVMRLRELLVAANVPCPSQSPALDLDVTQLSTNSWDCRPGTLFIGMPGTRVDGGNFWPSA
LAAGAIAAIVSPQAKQPNPNDSALVIPVDQIERACGQLATAFYNYPAQKLSLVGVTGTNG
KTTTTHLIEYLVKEAHQAPALFGTLYSRWPGHEVIATHTTPFAVTLQGQLATAVQAGAKV
GIMEVSSHSLAQGRTWGCEFTAAVFTNLTQDHLDYHKDLEDYFAAKALLFEENYLKGRAM
INGDDPYGQRLLRKLGQDQAWSYRTKGEADLWATDLQYRADGVSGIIHTPKGTRAFNSPL
VGQFNVENLLAALGVGLHLGLDLAGMLASLPQFPGVPGRMQQVKVSPAQDISVIVDYAHT
PDSLENLLKAARPFIPGQMICVFGCGGDRDRSKRPQMGKIAADLADQVVVTSDNPRTEYP
QGILEDILTGIEPTINPLVEADRHQAILDAILQAQPGDGVVIAGKGHEDYQILGTEKIHF
DDREEATAALKQRMGLE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggttatgcgtttacgagagcttttggttgcggctaatgttccctgccccagtcaatct
cccgctctagacctagatgtcactcaattaagtacaaattcttgggattgccggccggga
accttgtttattgggatgccgggaactcgtgtagatggggggaatttttggccgagtgct
ttagccgctggggccattgccgcaattgtctctccccaggccaagcaacctaaccccaat
gattcggccctcgtgatccctgtagatcagattgagcgggcctgtggacaactcgcaacc
gccttttacaactatccagcccaaaaactttcccttgtgggtgtgaccggaaccaatggc
aaaaccaccaccacccatttgattgaatatctggttaaggaagctcaccaggccccggct
ctctttggcaccctctatagtcgctggcctggccatgaagtgattgccacccataccact
ccctttgctgttactcttcaaggacaattagccactgctgtccaggccggggccaaggtg
gggattatggaggtgagttcccattccttagctcaaggacgaacctggggctgtgaattt
acagcggcggtgtttaccaatctcacccaagaccatttggactatcacaaggacttagag
gattattttgcggccaaggctctattgtttgaggagaactatctcaaagggcgagccatg
attaacggcgatgatccctatgggcaacggttactcagaaagttaggacaagaccaggcc
tggagttaccggactaaaggagaagctgacctttgggctacggatttacagtatcgggcc
gatggcgtttctggcatcattcacacccccaaaggaacaagagcctttaactcacccttg
gtgggtcaatttaatgtcgaaaacctactagcggctcttggggttgggttacatctgggc
ctagatctagctggaatgttagccagtttaccccagttccccggagtccccggccgaatg
cagcaggtcaaggttagtccagcgcaagatattagcgtgattgtagattatgcccacaca
ccggatagtttagaaaacttgctcaaagccgcccgcccgtttattcccggccagatgatc
tgtgtctttggctgtggtggagatcgggatcgcagcaaacgtccgcaaatgggaaaaatc
gccgccgatttagccgatcaagtagtcgtcacctcagataatccccgcacggaatacccc
caagggatcctagaggatattttgactgggattgagccaaccattaacccccttgtggaa
gctgaccgtcaccaggccattctcgacgcgattctccaggcccaacccggagatggggtg
gttattgctggcaaaggtcatgaagactatcaaattctgggcacagaaaaaattcatttt
gatgatcgggaagaagccaccgccgccttaaaacaacgcatgggcctggagtag

DBGET integrated database retrieval system