KEGG   Synechococcus sp. PCC 7502: Syn7502_00072Help
Entry
Syn7502_00072     CDS       T02371                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:synp03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(71313..72152)
Genome map
AA seq 279 aa AA seqDB search
MPELPEVETVRRSLHESTCDRQIISSEILLERTIAYPHNPEEFNLGLKGKRILSWHRRGK
YLLAELSNDSWLGVHLRMTGKLLWCDRSLPIHTHTRIRIYFANQQELRFNDQRTFGQMWL
VPSGINPEEIISGVQKLGMEPFDPNFNYEYLQNKLRKSDRPIKNSLLDQTVIAGIGNIYA
DESLFLSGIHPQTKSNQLTKSQLESLVQAIRRVLSDGITHGGTTFSDFVDIGGDKGNYIH
SAWVFRRTGQPCKVCSGVIARIKLGGRSTHFCPKCQPIS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacttccagaggtagaaaccgtacgacgtagtttgcatgaatccacctgcgat
cgccaaattattagcagtgagattttactagaacggacaatcgcttatccccataatcca
gaggaatttaacctagggctaaagggtaagcgaattctgtcttggcatagacggggcaaa
tatctcctagcagaactcagtaatgacagttggctaggagttcatttacgcatgacagga
aaattattgtggtgcgatcgctctttaccgattcatacacacacccgcattaggatttat
tttgccaaccagcaagaactaagatttaacgatcaacgtacctttggacagatgtggtta
gtgccgtcaggaataaatcctgaagagataattagcggcgttcaaaaattaggaatggaa
ccctttgaccccaattttaattatgaatacttacagaataaactgagaaaaagcgatcgc
ccaattaaaaactcattactagatcaaacggtaattgcaggtattggcaatatttatgct
gatgaaagtttattcctgagtggtattcatccccaaactaaatctaatcaacttactaaa
agtcaactagaatcactagtccaagcaattcggagagttttaagcgatggtattacccac
ggtggtaccacatttagtgattttgtggatattggcggcgataaaggtaactatattcat
tcggcttgggtatttagacggacgggacaaccctgtaaagtttgcagtggggttattgcc
agaattaaacttggtgggcgatctactcacttttgtcctaaatgtcagccgattagctaa

DBGET integrated database retrieval system