KEGG   Synechococcus sp. PCC 7502: Syn7502_00432Help
Entry
Syn7502_00432     CDS       T02371                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Syn7502_00432
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Syn7502_00432
Enzymes [BR:synp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Syn7502_00432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(439470..440801)
Genome map
AA seq 443 aa AA seqDB search
MPVTQSESIQTMLSNSQDRPESVLRIQGKATLSGHVPISGAKNSTLAIMAGALLCSGSSR
IRNVPAIVDVQKMIDILRAVGVKVTADRGALDIDAKNISQSHVPYDLVSQMRASFFVIGP
LLARMGVARVPLPGGCAIGTRPVDLHVKGLQALGADVIIDQGIIQAYCRQSRLQGAKIYL
DFPSVGATETLMMAATLAEGETVIENCAQEPEVVDLANFCRAMGAKIRGAGTKTIVIDGV
PRLHSTDFGIIPDRIEAATFMVAAAITRSTITISPVIPDHLTAAIAKLEEIGAKVVQESS
SRLRIEGKEKYRHTHIETLPYPGFPTDMQAQFMALLTLSEGNSTVKETVFENRLQHVAEL
CRMGANIKLQGNIAVINGVSSLSGAPVMATDLRASAALVLAGLAAEGETQMQGLHHLDRG
YDQLETKLRNLGAKLYRQPLVSE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgccagttacacaatctgaaagcattcaaactatgctgagcaacagtcaggatcgacct
gaatcagttctccgtattcaaggtaaagcaactctaagtggacatgttcccatcagtggt
gccaaaaattctaccctcgcaattatggcgggagctttactctgttctggtagctctcgc
attcgtaacgtacctgccattgttgatgtgcagaagatgattgatattctgagggctgtg
ggggtcaaagtaacagccgatcggggagccttagatattgatgctaagaacatttcccaa
tcccatgtgccctacgacttagtgagtcaaatgcgtgccagtttttttgtaattggtcca
cttttagcaaggatgggagtagctcgagtacctttacctggtggttgtgccattggtact
cgtcctgtggatttacatgttaagggactgcaggcactgggggctgatgtcattattgat
cagggtattatccaagcctattgtcgtcaatctcggttacagggggcaaaaatttacttg
gattttcctagtgtgggcgcaacggaaactttgatgatggcagccactttagcggaaggg
gaaactgtaattgaaaactgtgcccaagaaccagaggtagttgatctggctaacttttgt
cgggcaatgggggcaaaaattcgtggggctgggactaagactattgtgattgatggggtt
cctcgcttacattctacggattttggtattattcctgatcgcattgaagctgctacattt
atggttgctgctgcgattacccgttctactattactatttcccctgtgattcccgatcat
ctgacggcggcgatcgctaagttagaagaaattggtgccaaagtagtccaagaatcctcc
agtcgcttgcggattgaaggcaaagaaaaatatcggcatacccacattgagaccttaccc
tatcccggattccccacggatatgcaggcgcagtttatggcattattaactctcagtgaa
ggcaatagcactgttaaggaaaccgtatttgaaaatcgcctccagcacgttgccgaatta
tgtcgtatgggtgcaaatattaaactgcaaggtaatatcgccgtgattaatggagttagt
tctttatctggtgcaccagtgatggcaaccgatttacgggcatcggcagcattggtacta
gcgggcttagccgcagagggagaaacccaaatgcaaggactacatcacttagatcggggt
tatgatcaattagaaactaagttacggaacttgggagctaaactatatcgacagccattg
gtatctgaatag

DBGET integrated database retrieval system