KEGG   Synechococcus sp. PCC 7502: Syn7502_00449Help
Entry
Syn7502_00449     CDS       T02371                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Syn7502_00449
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syn7502_00449
   00520 Amino sugar and nucleotide sugar metabolism
    Syn7502_00449
Enzymes [BR:synp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Syn7502_00449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462328..463044
Genome map
AA seq 238 aa AA seqDB search
MEKLTLAIDVGGSGIKSMVLKADGTPHTQNLRVETPKPAKPEPVIAAIADLANIHKEFNQ
VSVGFPGVVRQGITKGAINLHPDWDNFDLGTVLYDRLGKPVRIANDADVQGLAAIAGRGT
ELVITLGTGFGSALFIDGRLVPNLELGQHQFRSGDTYEDRLGQRAFDKVGQKLWNRRLNK
AIDAIANLFNYDYLYIGGGNAKKIALKLPENVKIVPNIFGLIGGLALWSSQLNHWEQS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattaactctagcaattgatgtcggtggtagtgggatcaagtcgatggtctta
aaagcagatggcactccccatacccaaaatctgcgagttgaaaccccaaagccagctaaa
ccagagccagttattgcggcgatcgccgatctagctaatatccacaaagagtttaatcaa
gtttctgtaggatttcccggagttgtgcgccaaggcataaccaaaggagcaattaatctt
caccccgattgggataattttgatttaggcactgtactctatgatcgactgggtaaacct
gtgcgaatagcaaatgatgctgatgtgcaaggattagcagcgatcgcaggtagaggtaca
gagttagtcattacccttggtacaggcttcggctcggctttatttattgacggtcgacta
gtaccaaatctggaactggggcagcatcagtttcgcagtggcgatacctacgaagatcgg
ctaggacaacgggcatttgataaggttgggcaaaaactatggaatcgaagacttaataaa
gctatagatgcgatcgccaacctttttaactatgactatctatatattggtggtggtaat
gctaaaaaaatagcactgaaacttccagaaaatgtcaaaattgtaccgaatatatttgga
ttaattgggggactggctctatggtcatcacaattaaatcactgggaacaatcttaa

DBGET integrated database retrieval system