KEGG   Synechococcus sp. PCC 7502: Syn7502_00702Help
Entry
Syn7502_00702     CDS       T02371                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Syn7502_00702
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Syn7502_00702
Enzymes [BR:synp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Syn7502_00702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(717755..718732)
Genome map
AA seq 325 aa AA seqDB search
MSTRTWRHVISLEDFTVSDYELVIQTACSFREVLSRRNKKVPTLQGKVVANLFFEPSTRT
RNSFELAAKRLSADTLNFAPGSSSLSKGETILDTARTFLAMGTDIMVIRHQASGVPLAIA
QDMDKLSGNVGVLNAGDGKHEHPSQALLDLFTLTSYLNLGYPSVHDLKGKKILIVGDILH
SRVARSNLYCLVTLGADVHLVAPPTLLPADFSSYGVTIHHTLAPALEDADFIMTLRLQTE
RMGQFLVPSLREYHTQFGINRDRLVKCSPKVQVLHPGPVNRGVEISSDLMDDPRLSLIDK
QVTNGVATRMSLLYLMGASSGERII
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaagaacttggcgacatgtaatttccttagaggattttacggtatctgattat
gaattggtaatccaaacagcttgctcctttagggaagttttatctcggcgcaacaaaaaa
gttccaactctccaaggtaaggtcgttgctaatttattttttgagccatctacccgcact
cgcaacagctttgagttagcagcaaaacgactttcagcagacacgttaaattttgccccg
ggtagttcttctttatctaaaggtgaaacgatcttagatactgcccgcacatttctggca
atgggtaccgatattatggtgattcggcatcaagcttcaggagtaccactagcgatcgct
caggatatggataaactaagtggtaatgtgggagtcttaaatgcaggtgatggcaaacat
gagcatcccagtcaggctttactcgatttatttacattaactagttacttaaacctggga
tatccatccgtccatgatctaaaaggcaaaaaaattctgattgttggcgatatactccat
tcccgcgttgcccgttctaatctttattgcttggttaccttgggggctgatgtgcattta
gtcgctcccccaactttactacctgcagattttagtagctatggggtaactattcatcac
accctagcacccgctttagaagatgcggatttcattatgactttacgcctgcaaactgag
cgcatggggcagtttctagtacctagcctacgggaatatcatactcaatttggcattaac
cgcgatcgcctagttaaatgctcccctaaagtacaagttcttcaccctggaccagtgaac
cgaggcgtagaaattagttcagatttgatggatgatccccgcctgagcctaattgataaa
caggtaaccaatggcgttgctacccgcatgagcctactttatctaatgggcgcatccagt
ggtgaacgaattatttag

DBGET integrated database retrieval system