KEGG   Synechococcus sp. PCC 7502: Syn7502_00702Help
Entry
Syn7502_00702     CDS       T02371                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:synp00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:synp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(717755..718732)
Genome map
AA seq 325 aa AA seqDB search
MSTRTWRHVISLEDFTVSDYELVIQTACSFREVLSRRNKKVPTLQGKVVANLFFEPSTRT
RNSFELAAKRLSADTLNFAPGSSSLSKGETILDTARTFLAMGTDIMVIRHQASGVPLAIA
QDMDKLSGNVGVLNAGDGKHEHPSQALLDLFTLTSYLNLGYPSVHDLKGKKILIVGDILH
SRVARSNLYCLVTLGADVHLVAPPTLLPADFSSYGVTIHHTLAPALEDADFIMTLRLQTE
RMGQFLVPSLREYHTQFGINRDRLVKCSPKVQVLHPGPVNRGVEISSDLMDDPRLSLIDK
QVTNGVATRMSLLYLMGASSGERII
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaagaacttggcgacatgtaatttccttagaggattttacggtatctgattat
gaattggtaatccaaacagcttgctcctttagggaagttttatctcggcgcaacaaaaaa
gttccaactctccaaggtaaggtcgttgctaatttattttttgagccatctacccgcact
cgcaacagctttgagttagcagcaaaacgactttcagcagacacgttaaattttgccccg
ggtagttcttctttatctaaaggtgaaacgatcttagatactgcccgcacatttctggca
atgggtaccgatattatggtgattcggcatcaagcttcaggagtaccactagcgatcgct
caggatatggataaactaagtggtaatgtgggagtcttaaatgcaggtgatggcaaacat
gagcatcccagtcaggctttactcgatttatttacattaactagttacttaaacctggga
tatccatccgtccatgatctaaaaggcaaaaaaattctgattgttggcgatatactccat
tcccgcgttgcccgttctaatctttattgcttggttaccttgggggctgatgtgcattta
gtcgctcccccaactttactacctgcagattttagtagctatggggtaactattcatcac
accctagcacccgctttagaagatgcggatttcattatgactttacgcctgcaaactgag
cgcatggggcagtttctagtacctagcctacgggaatatcatactcaatttggcattaac
cgcgatcgcctagttaaatgctcccctaaagtacaagttcttcaccctggaccagtgaac
cgaggcgtagaaattagttcagatttgatggatgatccccgcctgagcctaattgataaa
caggtaaccaatggcgttgctacccgcatgagcctactttatctaatgggcgcatccagt
ggtgaacgaattatttag

DBGET integrated database retrieval system